KEGG   Mus musculus (mouse): 16818Help
Entry
16818             CDS       T01002                                 

Gene name
Lck, Hck-3, Lsk, Lskt, p56<lck>, p56Lck
Definition
(RefSeq) lymphocyte protein tyrosine kinase
  KO
K05856  
lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
T cell receptor signaling pathway
HTLV-I infection
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    16818 (Lck)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    16818 (Lck)
   04660 T cell receptor signaling pathway
    16818 (Lck)
   04658 Th1 and Th2 cell differentiation
    16818 (Lck)
  Development
   04380 Osteoclast differentiation
    16818 (Lck)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    16818 (Lck)
  Infectious diseases
   05166 HTLV-I infection
    16818 (Lck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16818 (Lck)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   16818 (Lck)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    16818 (Lck)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD48, BCM1; CD48 antigen [KO:K06479]
     16818 (Lck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D2.2; 4 63.26 cM
AA seq 509 aa AA seqDB search
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtctgcagctcaaaccctgaagatgactggatggagaacattgacgtgtgt
gaaaactgccactatcccatagtcccactggacagcaagatctcgctgcccatccggaat
ggctctgaagtgcgggacccactggtcacctatgagggatctctcccaccagcatccccg
ctgcaagacaacctggttatcgccctgcacagttatgagccctcccatgatggagacttg
ggctttgagaagggtgaacagctccgaatcctggagcagagcggtgagtggtggaaggct
cagtccctgacgactggccaagaaggcttcattcccttcaacttcgtggcgaaagcaaac
agcctggagcctgaaccttggttcttcaagaatctgagccgtaaggacgccgagcggcag
cttttggcgcccgggaacacgcatggatccttcctgatccgggaaagcgaaagcactgcg
gggtccttttccctgtcggtcagagacttcgaccagaaccagggagaagtggtgaaacat
tacaagatccgtaacctagacaacggtggcttctacatctcccctcgtatcacttttccc
ggattgcacgatctagtccgccattacaccaacgcctctgatgggctgtgcacaaagttg
agccgtccttgccagacccagaagccccagaaaccatggtgggaggacgaatgggaagtt
cccagggaaacactgaagttggtggagcggctgggagctggccagttcggggaagtgtgg
atggggtactacaacggacacacgaaggtggcggtgaagagtctgaaacaagggagcatg
tcccccgacgccttcctggctgaggctaacctcatgaagcagctgcagcacccgcggcta
gtccggctttatgcagtggtcacccaggaacccatctacatcatcacggaatacatggag
aacgggagcctagtagattttctcaagactccctcgggcatcaagttgaatgtcaacaaa
cttttggacatggcagcccagattgcagagggcatggcgttcatcgaagaacagaattac
atccatcgggacctgcgcgccgccaacatcctggtgtctgacacgctgagctgcaagatt
gcagactttggcctggcgcgcctcattgaggacaatgagtacacggcccgggagggggcc
aaatttcccattaagtggacagcaccagaagccattaactatgggaccttcaccatcaag
tcagacgtgtggtccttcgggatcttgcttacagagatcgtcacccacggtcgaatccct
tacccaggaatgaccaaccctgaagtcattcagaacctggagagaggctaccgcatggtg
agacctgacaactgtccggaagagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggaccggcccacgtttgactaccttcggagtgttctggatgacttcttcacagcc
acagagggccagtaccagccccagccttga

DBGET integrated database retrieval system