KEGG   Mus musculus (mouse): 16818Help
Entry
16818             CDS       T01002                                 

Gene name
Lck, Hck-3, Lsk, Lskt, p56<lck>, p56Lck
Definition
(RefSeq) lymphocyte protein tyrosine kinase (EC:2.7.10.2)
  KO
K05856  
lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
HTLV-I infection
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    16818 (Lck)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    16818 (Lck)
   04660 T cell receptor signaling pathway
    16818 (Lck)
  Development
   04380 Osteoclast differentiation
    16818 (Lck)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    16818 (Lck)
  Infectious diseases
   05166 HTLV-I infection
    16818 (Lck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16818 (Lck)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   16818 (Lck)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    16818 (Lck)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD48, BCM1; CD48 antigen [KO:K06479]
     16818 (Lck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D2.2; 4 63.26 cM
AA seq 509 aa AA seqDB search
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtctgcagctcaaaccctgaagatgactggatggagaacattgacgtgtgt
gaaaactgccactatcccatagtcccactggacagcaagatctcgctgcccatccggaat
ggctctgaagtgcgggacccactggtcacctatgagggatctctcccaccagcatccccg
ctgcaagacaacctggttatcgccctgcacagttatgagccctcccatgatggagacttg
ggctttgagaagggtgaacagctccgaatcctggagcagagcggtgagtggtggaaggct
cagtccctgacgactggccaagaaggcttcattcccttcaacttcgtggcgaaagcaaac
agcctggagcctgaaccttggttcttcaagaatctgagccgtaaggacgccgagcggcag
cttttggcgcccgggaacacgcatggatccttcctgatccgggaaagcgaaagcactgcg
gggtccttttccctgtcggtcagagacttcgaccagaaccagggagaagtggtgaaacat
tacaagatccgtaacctagacaacggtggcttctacatctcccctcgtatcacttttccc
ggattgcacgatctagtccgccattacaccaacgcctctgatgggctgtgcacaaagttg
agccgtccttgccagacccagaagccccagaaaccatggtgggaggacgaatgggaagtt
cccagggaaacactgaagttggtggagcggctgggagctggccagttcggggaagtgtgg
atggggtactacaacggacacacgaaggtggcggtgaagagtctgaaacaagggagcatg
tcccccgacgccttcctggctgaggctaacctcatgaagcagctgcagcacccgcggcta
gtccggctttatgcagtggtcacccaggaacccatctacatcatcacggaatacatggag
aacgggagcctagtagattttctcaagactccctcgggcatcaagttgaatgtcaacaaa
cttttggacatggcagcccagattgcagagggcatggcgttcatcgaagaacagaattac
atccatcgggacctgcgcgccgccaacatcctggtgtctgacacgctgagctgcaagatt
gcagactttggcctggcgcgcctcattgaggacaatgagtacacggcccgggagggggcc
aaatttcccattaagtggacagcaccagaagccattaactatgggaccttcaccatcaag
tcagacgtgtggtccttcgggatcttgcttacagagatcgtcacccacggtcgaatccct
tacccaggaatgaccaaccctgaagtcattcagaacctggagagaggctaccgcatggtg
agacctgacaactgtccggaagagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggaccggcccacgtttgactaccttcggagtgttctggatgacttcttcacagcc
acagagggccagtaccagccccagccttga

DBGET integrated database retrieval system