KEGG   Mus musculus (mouse): 16828Help
Entry
16828             CDS       T01002                                 

Gene name
Ldha, Ldh1, Ldhm, l7R2
Definition
(RefSeq) lactate dehydrogenase A
  KO
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
HIF-1 signaling pathway
Glucagon signaling pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    16828 (Ldha)
   00620 Pyruvate metabolism
    16828 (Ldha)
   00640 Propanoate metabolism
    16828 (Ldha)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    16828 (Ldha)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    16828 (Ldha)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    16828 (Ldha)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    16828 (Ldha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     16828 (Ldha)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16828 (Ldha)
  Exosomal proteins of breast milk
   16828 (Ldha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B3; 7 30.6 cM
AA seq 332 aa AA seqDB search
MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGI
SDVVKVTLTPEEEARLKKSADTLWGIQKELQF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccctcaaggaccagctgattgtgaatcttcttaaggaagagcaggctccccag
aacaagattacagttgttggggttggtgctgttggcatggcttgtgccatcagtatctta
atgaaggacttggcggatgagcttgcccttgttgacgtcatggaagacaaactcaagggc
gagatgatggatctccagcatggcagcctcttccttaaaacaccaaaaattgtctccagc
aaagactactgtgtaactgcgaactccaagctggtcattatcaccgcgggggcccgtcag
caagagggggagagccggctcaacctggtccagcgaaacgtgaacatcttcaagttcatc
attcccaacattgtcaagtacagtccacactgcaagctgctgatcgtctccaatccagtg
gatatcttgacctacgtggcttggaaaatcagtggctttcccaaaaaccgagtaattgga
agtggttgcaatctggattcagcgcggttccgttacctgatgggagagaggctgggggtt
cacgcgctgagctgtcacggctgggtcctgggagaacatggcgactccagtgtgcctgtg
tggagtggtgtgaatgttgccggcgtctccctgaagtctcttaacccagaactgggcact
gacgcagacaaggagcagtggaaggaggttcacaagcaggtggtggacagtgcctacgag
gtgatcaagctgaaaggttacacatcctgggccattggcctctctgtggcagacttggct
gagagcataatgaagaaccttaggcgggtgcatcccatttccaccatgattaagggtctc
tatggaatcaatgaggatgtcttcctcagtgtcccatgtatcctgggacaaaatggaatc
tcggatgttgtgaaggtgacactgactcctgaggaagaggcccgcctgaagaagagcgca
gacaccctctggggaatccagaaggagctgcagttctaa

DBGET integrated database retrieval system