KEGG   Mus musculus (mouse): 16867Help
Entry
16867             CDS       T01002                                 

Gene name
Lhcgr, Gpcr19-rs1, LH-R, Lhr
Definition
(RefSeq) luteinizing hormone/choriogonadotropin receptor
  KO
K04248  
luteinizing hormone/choriogonadotropin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Ovarian steroidogenesis
Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    16867 (Lhcgr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    16867 (Lhcgr)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    16867 (Lhcgr)
   04917 Prolactin signaling pathway
    16867 (Lhcgr)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Lutropin-choriogonadotropic hormone
    16867 (Lhcgr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 E4-E5; 17 58.35 cM
AA seq 700 aa AA seqDB search
MGRRVPALRQLLVLAMLVLKQSQLHSPELSGSRCPEPCDCAPDGALRCPGPRAGLARLSL
TYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSEILIQNTKNLLYIEP
GAFTNLPRLKYLSICNTGIRTLPDVSKISSSEFNFILEICDNLYITTIPGNAFQGMNNES
ITLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGTFQGATGPSILDVSSTKLQA
LPSHGLESIQTLIATSSYSLKTLPSREKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSI
FENFSKQCESTVREANNETLYSAIFEENELSGWDYDYDFCSPKTLQCTPEPDAFNPCEDI
MGYAFLRVLIWLINILAIFGNLTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIA
SVDSQTKGQYYNHAIDWQTGSGCSAAGFFTVFASELSVYTLTVITLERWHTITYAVQLDQ
KLRLRHAIPIMLGGWIFSTLMATLPLVGVSSYMKVSICLPMDVESTLSQVYILSILLLNA
VAFVVICACYVRIYFAVQNPELTAPNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKV
PLITVTNSKVLLVLFYPVNSCANPFLYAVFTKAFQRDFFLLLSRFGCCKHRAELYRRKEF
SACTFNSKNGFPRSSKPSQAALKLSIVHCQQPTPPRVLIQ
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggggcggcgggtcccggctctgagacagctgctggtgctggcaatgctggtgctgaag
cagtcacagctgcactctccagagttgtcagggtcgcgctgccctgagccctgcgactgc
gcgccggatggtgccctgcgctgccctggccctcgagctggcctcgcccgactatctctc
acctatctccctgtcaaagtaatcccatcacaagctttcaggggacttaatgaggtcgta
aaaattgaaatctctcagagtgattccctggaaaggatagaagctaatgcctttgacaac
ctcctcaatctgtctgaaatactgatccagaacaccaaaaacctgctatacattgaaccc
ggtgcttttacaaacctccctcggttaaaatacctgagcatctgtaacacaggcatccgg
accctcccagatgtttcgaagatctcttcctctgaatttaatttcattctggaaatctgt
gataacttatacataaccaccataccagggaacgctttccaagggatgaataatgagtcc
atcacgctgaaactgtatggaaatgggtttgaagaagtacaaagccatgcattcaatggg
acgacgctaatctcgctggagttaaaagaaaacatctacctggagaagatgcacagtggc
accttccagggggccacggggcccagcatcctggatgtctcttccaccaaattgcaggcc
ctgccgagccacgggctggagtccattcagacgctcatcgccacgtcatcctactcactg
aaaactctgccctccagagaaaaattcaccagcctactggttgccacgctgacctaccct
agccactgctgtgctttcaggaatttgccgaagaaagaacagaatttttcattttccatt
tttgaaaacttttccaaacaatgtgaaagcacagttagagaagcgaataacgagacgctt
tattctgccatctttgaggagaatgaactcagtggctgggattacgattatgacttctgt
tcacccaagacactccaatgtactccagaaccagatgctttcaatccctgtgaagatatt
atgggctatgccttccttagggtgttgatttggctaattaatatactagccatctttggc
aacttgacagtcctctttgttctcctgaccagtcgttataaactgacggtgccccgcttc
ctcatgtgtaatctctcctttgcagacttttgcatggggctctacctgctgctcattgcc
tcagtagactcccaaacaaaaggccagtactataaccatgccatagactggcagacaggg
agtggctgcagtgcagctggcttctttactgtgttcgccagtgaactttctgtctatacc
cttacagtcatcactctggaaaggtggcacaccatcacctatgctgttcagctggaccaa
aagctgaggctgagacatgccatcccaattatgctcggaggatggattttttctaccctg
atggccacattgccccttgtgggtgtcagcagttacatgaaagtcagcatctgcctcccc
atggatgtggaatccactctgtcacaagtctacatattatccatcttgctcctcaatgca
gtggcctttgtcgtcatctgtgcttgctacgttaggatatactttgcagttcaaaatcca
gagctgacggctcctaacaaggacacaaaaattgctaagaagatggccatcctcatcttc
acagacttcacatgcatggcacccatctcattctttgccatctcagctgccttcaaagta
ccccttatcactgtcaccaactcaaaagttctgctggtccttttttatcctgtcaattct
tgtgccaacccatttctgtacgcagtgttcacgaaggcatttcagagagatttctttctc
ttgctgagcagatttggttgctgtaagcaccgggctgaactttacagaaggaaggaattt
tctgcatgtaccttcaactccaaaaacggctttccaagatcaagtaagccttcccaggct
gccctgaagttatccatagtgcactgtcaacaacctacacctccaagagtgttaattcag
taa

DBGET integrated database retrieval system