KEGG   Mus musculus (mouse): 16890Help
Entry
16890             CDS       T01002                                 

Gene name
Lipe, 4933403G17Rik, HSL
Definition
(RefSeq) lipase, hormone sensitive (EC:3.1.1.79)
  KO
K07188  
hormone-sensitive lipase [EC:3.1.1.79]
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    16890 (Lipe)
   04152 AMPK signaling pathway
    16890 (Lipe)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    16890 (Lipe)
   04923 Regulation of lipolysis in adipocyte
    16890 (Lipe)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     16890 (Lipe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7 13.78 cM
AA seq 759 aa AA seqDB search
MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHH
FDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRASHNLAELEAYLAALTQ
LRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGCFYGRCLGFQFTPAIRPF
LQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKA
FWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPV
LARLISYDLREGQDSKVLNSLAKSEGPRLELRPRPHQAPRSRALVVHIHGGGFVAQTSKS
HEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAYCWAVKHCDLLGSTGERICLA
GDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQSSASPSRLLSLMDPLLPLSVLSK
CVSAYSGTEAEDHFDSDQKALGVMGLVQRDTSLFLRDLRLGASSWLNSFLELSGRKPQKT
TSPTAESVRPTESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMET
LGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRSSQGVLHMPLY
TSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDSVMFARRLRDLGQPVTLKVVE
DLPHGFLSLAALCRETRQATEFCVQRIRLILTPPAAPLN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgcacgatgacacagtcgctggtgacactcgcagaagacaatatggccttc
ttctcaagccagggcccaggagagacagcacggcggctgtctaatgtctttgcaggtgtt
cgggaacaggcactggggctggaaccaaccctaggccaactgttgggtgtggcacaccat
tttgacctggacacagagacaccagccaacggataccgtagtttggtgcacacagcccga
tgctgcctggcacacctactacacaaatcccgctatgtggcttctaaccgcaaaagtatc
ttcttccgtgccagccacaacctagcagagctggaggcctacctggccgccctcacccag
ctccgtgctatggcctactatgcccagcgcctgctgaccatcaaccgaccaggagtgctc
ttcttcgagggtgatgaaggactcaccgctgacttcctgcaagagtatgtcacgctacac
aaaggctgcttctacggccgctgcctgggcttccagttcacacctgccatccggccgttc
ctgcagactctctccatcgggctggtgtccttcggggagcactacaaacgcaacgagaca
ggcctcagtgtgaccgccagttccctctttaccggtggccgattcgccatagacccagag
ttgcgtggggctgaatttgaacgcatcatacagaacctggatgtgcacttctggaaagcc
ttctggaacatcactgagattgaggtgctgtcgtctctggccaacatggcatcaaccact
gtgagggtaagccgcctgctcagcttgccacctgaggcctttgagatgccactcacctct
gatcccaggctcacagttaccatctcacctcccttggcacacacgggaccagctcctgtg
ctagccaggctcatctcctatgacctacgggaaggacaggacagcaaggtactcaacagc
ctggcaaaatctgagggcccacgcctggagctgcgcccacggcctcaccaagcaccccgt
tcacgggccctggttgttcacatccacggaggcggctttgtggcacagacctctaaatcc
cacgagccctacctcaagaactgggcccaggagctaggagtccctatcttctccatcgac
tactccctggcccccgaggctccctttccccgagcgctggaggagtgtttttttgcctac
tgctgggctgtcaagcactgtgacctgcttggttcaactggagagcggatatgccttgca
ggggacagtgcaggtgggaatctctgcatcactgtgtcccttcgggcagcagcctatgga
gtgagggtgccagatggcatcatggcagcctacccagttaccaccctgcagtcctctgct
tctccctctcgtctgctgagcctcatggaccctcttctaccactgagcgtactctctaag
tgtgtcagtgcctattcagggacagaggcagaggaccattttgactcagaccagaaggca
ctaggcgtgatggggctggtgcagagagacacttcgctgttcctcagagacctccgactg
ggtgcctcctcatggctcaactccttcctggaactaagtggacgcaagccccaaaagacc
acatcgcccacagcagagtctgtgcgccccacggagtctatgcgcaggagtgtgtctgag
gcagccctggcccagcctgagggcttactgggcacagataccttgaagaagctgacaata
aaggacttgagcaactcagagccttcagacagccccgagatgtcacagtcaatggagaca
cttggcccctccacaccctctgatgtcaacttttttctgcggcctgggaattcccaggaa
gaggctgaagccaaagatgaagtgagacccatggacggagtcccccgcgtgcgcgctgct
ttccctgaggggtttcacccccggcgctcaagccaaggtgtcctccacatgcccctctac
acgtcacccatagtcaagaaccccttcatgtctcctctgctggcccctgacagcatgctg
aagaccttgccgcctgtgcaccttgtggcttgcgctctggaccccatgctagatgactcg
gtcatgttcgcgcggcgactgcgcgacctgggccagccggtgacgctgaaagtggtagaa
gatctgccgcatggcttcctgagcctggcggcactgtgtcgcgagacccggcaggccacg
gagttctgcgtgcagcgcatccggctgatcctcaccccgcctgctgcaccactgaactga

DBGET integrated database retrieval system