KEGG   Mus musculus (mouse): 16890Help
Entry
16890             CDS       T01002                                 

Gene name
Lipe, 4933403G17Rik, HSL
Definition
lipase, hormone sensitive (EC:3.1.1.79)
Orthology
K07188  
hormone-sensitive lipase [EC:3.1.1.79]
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    16890 (Lipe)
   04152 AMPK signaling pathway
    16890 (Lipe)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    16890 (Lipe)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     16890 (Lipe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7 13.78 cM
AA seq 759 aa AA seqDB search
MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHH
FDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRASHNLAELEAYLAALTQ
LRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGCFYGRCLGFQFTPAIRPF
LQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKA
FWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPV
LARLISYDLREGQDSKVLNSLAKSEGPRLELRPRPHQAPRSRALVVHIHGGGFVAQTSKS
HEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAYCWAVKHCDLLGSTGERICLA
GDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQSSASPSRLLSLMDPLLPLSVLSK
CVSAYSGTEAEDHFDSDQKALGVMGLVQRDTSLFLRDLRLGASSWLNSFLELSGRKPQKT
TSPTAESVRPTESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMET
LGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRSSQGVLHMPLY
TSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDSVMFARRLRDLGQPVTLKVVE
DLPHGFLSLAALCRETRQATEFCVQRIRLILTPPAAPLN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgcacgatgacacagtcgctggtgacactcgcagaagacaatatggccttc
ttctcaagccagggcccaggagagacagcacggcggctgtctaatgtctttgcaggtgtt
cgggaacaggcactggggctggaaccaaccctaggccaactgttgggtgtggcacaccat
tttgacctggacacagagacaccagccaacggataccgtagtttggtgcacacagcccga
tgctgcctggcacacctactacacaaatcccgctatgtggcttctaaccgcaaaagtatc
ttcttccgtgccagccacaacctagcagagctggaggcctacctggccgccctcacccag
ctccgtgctatggcctactatgcccagcgcctgctgaccatcaaccgaccaggagtgctc
ttcttcgagggtgatgaaggactcaccgctgacttcctgcaagagtatgtcacgctacac
aaaggctgcttctacggccgctgcctgggcttccagttcacacctgccatccggccgttc
ctgcagactctctccatcgggctggtgtccttcggggagcactacaaacgcaacgagaca
ggcctcagtgtgaccgccagttccctctttaccggtggccgattcgccatagacccagag
ttgcgtggggctgaatttgaacgcatcatacagaacctggatgtgcacttctggaaagcc
ttctggaacatcactgagattgaggtgctgtcgtctctggccaacatggcatcaaccact
gtgagggtaagccgcctgctcagcttgccacctgaggcctttgagatgccactcacctct
gatcccaggctcacagttaccatctcacctcccttggcacacacgggaccagctcctgtg
ctagccaggctcatctcctatgacctacgggaaggacaggacagcaaggtactcaacagc
ctggcaaaatctgagggcccacgcctggagctgcgcccacggcctcaccaagcaccccgt
tcacgggccctggttgttcacatccacggaggcggctttgtggcacagacctctaaatcc
cacgagccctacctcaagaactgggcccaggagctaggagtccctatcttctccatcgac
tactccctggcccccgaggctccctttccccgagcgctggaggagtgtttttttgcctac
tgctgggctgtcaagcactgtgacctgcttggttcaactggagagcggatatgccttgca
ggggacagtgcaggtgggaatctctgcatcactgtgtcccttcgggcagcagcctatgga
gtgagggtgccagatggcatcatggcagcctacccagttaccaccctgcagtcctctgct
tctccctctcgtctgctgagcctcatggaccctcttctaccactgagcgtactctctaag
tgtgtcagtgcctattcagggacagaggcagaggaccattttgactcagaccagaaggca
ctaggcgtgatggggctggtgcagagagacacttcgctgttcctcagagacctccgactg
ggtgcctcctcatggctcaactccttcctggaactaagtggacgcaagccccaaaagacc
acatcgcccacagcagagtctgtgcgccccacggagtctatgcgcaggagtgtgtctgag
gcagccctggcccagcctgagggcttactgggcacagataccttgaagaagctgacaata
aaggacttgagcaactcagagccttcagacagccccgagatgtcacagtcaatggagaca
cttggcccctccacaccctctgatgtcaacttttttctgcggcctgggaattcccaggaa
gaggctgaagccaaagatgaagtgagacccatggacggagtcccccgcgtgcgcgctgct
ttccctgaggggtttcacccccggcgctcaagccaaggtgtcctccacatgcccctctac
acgtcacccatagtcaagaaccccttcatgtctcctctgctggcccctgacagcatgctg
aagaccttgccgcctgtgcaccttgtggcttgcgctctggaccccatgctagatgactcg
gtcatgttcgcgcggcgactgcgcgacctgggccagccggtgacgctgaaagtggtagaa
gatctgccgcatggcttcctgagcctggcggcactgtgtcgcgagacccggcaggccacg
gagttctgcgtgcagcgcatccggctgatcctcaccccgcctgctgcaccactgaactga

DBGET integrated database retrieval system