KEGG   Mus musculus (mouse): 16906Help
Entry
16906             CDS       T01002                                 

Gene name
Lmnb1
Definition
(RefSeq) lamin B1
  KO
K07611  
lamin B
Organism
mmu  Mus musculus (mouse)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    16906 (Lmnb1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     16906 (Lmnb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18 D3; 18 30.84 cM
AA seq 588 aa AA seqDB search
MATATPVQQQRAGSRASAPATPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSA
LQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLL
NYAKKESDLSGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLSA
AKKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEYE
YKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMR
IESLSSQLSNLQKESRACLERIQELEDMLAKERDNSRRMLSDREREMAEIRDQMQQQLSD
YEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRV
DVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTS
VSYKYTSRYVLKAGQTVTVWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEV
AQRSTVFKTTIPEEEEEEEEEPIGVAVEEERFHQQGAPRASNKSCAIM
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcgacccccgtgcagcagcagcgggcgggcagccgcgccagcgcccccgcc
acgccgctcagccccacgcgcctgtcgcgcctgcaggagaaagaggagctgcgggagctc
aacgaccgcctggctgtgtacatcgataaggtgcgcagcctggagacggagaacagcgcg
ctgcagctgcaggtgaccgagcgcgaggaggtgcgcggccgcgagctcaccggcctcaag
gctctctacgagaccgagctggccgacgcacgccgcgctctggacgacacggcccgcgag
cgcgccaagctccagatcgagctgggcaagttcaaggccgagcacgaccagctgctgctc
aattatgccaagaaggaatctgatctcagtggagcccagatcaagcttcgagagtatgag
gcggcactaaactctaaggatgcggcgctggctactgccctaggggacaaaaagagttta
gagggagacttggaggatctgaaagatcagattgcccagctagaagcatccttatctgcc
gccaaaaagcagttagcagatgaaactttacttaaagtggatttggagaatcgctgtcag
agccttactgaggacttggagtttcgtaaaaatatgtatgaagaggagatcaatgagaca
aggaggaagcatgagacccgcttggtggaagtggactctgggcgtcagattgagtatgag
tacaagctggctcaagccctgcatgagatgcgggagcagcacgacgcgcaggtgaggctg
tacaaggaagagctggagcagacctaccacgccaagcttgagaatgccagactctcctca
gagatgaacacttccactgtcaacagtgcccgggaagagctgatggagagccggatgagg
atcgagagcctctcctcacagctctctaacctgcagaaagagtctagagcgtgtttggaa
aggatccaggaattggaggacatgcttgctaaggagagagacaactcgcgccgcatgctg
tctgacagagagagagagatggcggagatcagggaccagatgcagcagcagctgagtgat
tatgagcagctgctggacgtgaagctggccctggacatggagatcagcgcctacaggaag
ctcctggaaggcgaagaagagcggttaaagctctctccaagcccttcttcccgggtgacc
gtgtccagagcgtcctccagtcgcagtgtgcgcaccaccagaggaaagcggaagagagtt
gatgtggaggagtcggaggcgagcagcagtgttagcatttcccactctgcctcagccacg
gggaacgtgtgcattgaagagatagatgttgatgggaagtttattcgcttgaagaacact
tctgagcaggatcaaccaatgggaggctgggagatgatcagaaaaattggagacacatca
gtcagttacaaatatacctcaagatatgtgctgaaggctggccagactgtcacagtgtgg
gctgcaaatgctggcgtcacagccagccctccaactgacctcatctggaagaaccagaac
tcttggggtactggtgaagatgtgaaggttatattgaagaattctcagggagaggaggtt
gctcagagaagcacagtcttcaagaccaccatacccgaggaggaggaggaggaggaggag
gagcccatcggagtggctgtggaggaggagcgtttccaccagcagggagccccaagagca
tccaataaaagctgtgccattatgtga

DBGET integrated database retrieval system