KEGG   Mus musculus (mouse): 16913Help
Entry
16913             CDS       T01002                                 

Gene name
Psmb8, Lmp-7, Lmp7
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7) (EC:3.4.25.1)
  KO
K02740  
20S proteasome subunit beta 8 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Proteasome
Module
Immunoproteasome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    16913 (Psmb8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     16913 (Psmb8)
Peptidases [BR:mmu01002]
 Threonine Peptidases
  Family T1: proteasome family
   16913 (Psmb8)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    16913 (Psmb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
17 B1; 17 17.98 cM
AA seq 276 aa AA seqDB search
MALLDLCGAARGQRPEWAALDAGSGGRSDPGHYSFSAQAPELALPRGMQPTAFLRSFGGD
QERNVQIEMAHGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKG
PGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYATHRDN
YSGGVVNMYHMKEDGWVKVESSDVSDLLYKYGEAAL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcgttactggatctgtgcggtgccgctcgggggcagcggcccgagtgggctgccctg
gatgcgggaagcgggggtcgctcggacccgggacactacagtttctccgcgcaagctccg
gagctcgcacttccccggggaatgcagcccaccgcattcctgaggtcctttggtggtgac
caggaaaggaatgttcaaattgagatggcccacggcacaaccacactcgccttcaagttc
cagcatggcgtcatcgtggctgtggactccagggccactgcagggagttacattagctcc
ttaaggatgaacaaagtgatcgagattaacccttacctgcttggcaccatgtctggttgt
gcagccgactgccagtactgggagaggctgttggccaaggagtgcaggttgtattatctt
cggaatggggaacgcatctccgtgtctgcagcatccaagctgctttccaacatgatgctg
cagtaccgggggatgggcctctccatgggcagcatgatctgtggctgggacaagaaggga
ccaggactttactacgtagatgacaatgggactcggctctcgggacagatgttttccact
ggcagcgggaacacctatgcctatggggtgatggacagtggttaccggcaggacctcagt
cctgaagaggcctacgaccttggccgcagagctattgcttatgctacccacagagacaac
tattctggaggagtcgtcaacatgtaccacatgaaggaagacggttgggtgaaagtggag
agttccgatgtcagtgacctgctgtacaagtacggagaggccgctctgtga

DBGET integrated database retrieval system