KEGG   Mus musculus (mouse): 16952Help
Entry
16952             CDS       T01002                                 

Gene name
Anxa1, Anx-1, Anx-A1, C430014K04Rik, Lpc-1, Lpc1
Definition
(RefSeq) annexin A1
  KO
K17091  
annexin A1
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   16952 (Anxa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 B; 19 13.83 cM
AA seq 346 aa AA seqDB search
MAMVSEFLKQARFLENQEQEYVQAVKSYKGGPGSAVSPYPSFNVSSDVAALHKAIMVKGV
DEATIIDILTKRTNAQRQQIKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQFDA
DELRGAMKGLGTDEDTLIEILTTRSNEQIREINRVYREELKRDLAKDITSDTSGDFRKAL
LALAKGDRCQDLSVNQDLADTDARALYEAGERRKGTDVNVFTTILTSRSFPHLRRVFQNY
GKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAEKLYEAMKGAGTRHKALIRIM
VSRSEIDMNEIKVFYQKKYGISLCQAILDETKGDYEKILVALCGGN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggtatcagaattcctcaagcaggcccgttttcttgaaaatcaagaacaggaa
tatgttcaagctgtaaaatcatacaaaggtggtcctgggtcagcagtgagcccctaccct
tccttcaatgtatcctcggatgttgctgccttgcacaaagctatcatggttaaaggtgtg
gatgaagcaaccatcattgacattcttaccaagaggaccaatgctcagcgccagcagatc
aaggccgcgtacttacaggagaatggaaagcccttggatgaagtcttgagaaaagccctt
acaggccacctggaggaggttgttttggctatgctaaaaactccagctcagtttgatgca
gatgaactccgtggtgccatgaagggacttggaacagatgaagacactctcattgagatt
ttgacaacaagatctaacgaacaaatcagagagattaatagagtctacagagaagagctg
aaaagagatctggccaaagacatcacttcagatacatctggagactttcggaaagccttg
cttgctcttgccaagggtgaccgttgtcaggacttgagtgtgaatcaagatttggctgat
acagatgccagggctttgtatgaagctggagaaaggagaaaggggacagacgtgaacgtc
ttcaccacaattctgaccagcaggagctttcctcatcttcgcagagtgtttcagaattac
ggaaagtacagtcaacatgacatgaacaaagctctggatctggaactgaagggtgacatt
gagaagtgcctcacaaccatcgtgaagtgtgccaccagcactccagctttctttgccgag
aagctgtacgaagccatgaagggtgccggaactcgccataaggcattgatcaggattatg
gtctcccgttcggaaattgacatgaatgaaatcaaagtattttaccagaagaagtatgga
atctctctttgccaagccatcctggatgaaaccaaaggagactatgaaaaaatcctggtg
gctctgtgtggtggaaactag

DBGET integrated database retrieval system