KEGG   Mus musculus (mouse): 16952Help
Entry
16952             CDS       T01002                                 

Gene name
Anxa1, Anx-1, Anx-A1, C430014K04Rik, Lpc-1, Lpc1
Definition
(RefSeq) annexin A1
  KO
K17091  annexin A1
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    16952 (Anxa1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   16952 (Anxa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 16952
NCBI-ProteinID: NP_034860
MGI: 96819
Ensembl: ENSMUSG00000024659
Vega: OTTMUSG00000035986
UniProt: P10107 Q4FJV4
Position
19 B; 19 13.83 cM
AA seq 346 aa AA seqDB search
MAMVSEFLKQARFLENQEQEYVQAVKSYKGGPGSAVSPYPSFNVSSDVAALHKAIMVKGV
DEATIIDILTKRTNAQRQQIKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQFDA
DELRGAMKGLGTDEDTLIEILTTRSNEQIREINRVYREELKRDLAKDITSDTSGDFRKAL
LALAKGDRCQDLSVNQDLADTDARALYEAGERRKGTDVNVFTTILTSRSFPHLRRVFQNY
GKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAEKLYEAMKGAGTRHKALIRIM
VSRSEIDMNEIKVFYQKKYGISLCQAILDETKGDYEKILVALCGGN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggtatcagaattcctcaagcaggcccgttttcttgaaaatcaagaacaggaa
tatgttcaagctgtaaaatcatacaaaggtggtcctgggtcagcagtgagcccctaccct
tccttcaatgtatcctcggatgttgctgccttgcacaaagctatcatggttaaaggtgtg
gatgaagcaaccatcattgacattcttaccaagaggaccaatgctcagcgccagcagatc
aaggccgcgtacttacaggagaatggaaagcccttggatgaagtcttgagaaaagccctt
acaggccacctggaggaggttgttttggctatgctaaaaactccagctcagtttgatgca
gatgaactccgtggtgccatgaagggacttggaacagatgaagacactctcattgagatt
ttgacaacaagatctaacgaacaaatcagagagattaatagagtctacagagaagagctg
aaaagagatctggccaaagacatcacttcagatacatctggagactttcggaaagccttg
cttgctcttgccaagggtgaccgttgtcaggacttgagtgtgaatcaagatttggctgat
acagatgccagggctttgtatgaagctggagaaaggagaaaggggacagacgtgaacgtc
ttcaccacaattctgaccagcaggagctttcctcatcttcgcagagtgtttcagaattac
ggaaagtacagtcaacatgacatgaacaaagctctggatctggaactgaagggtgacatt
gagaagtgcctcacaaccatcgtgaagtgtgccaccagcactccagctttctttgccgag
aagctgtacgaagccatgaagggtgccggaactcgccataaggcattgatcaggattatg
gtctcccgttcggaaattgacatgaatgaaatcaaagtattttaccagaagaagtatgga
atctctctttgccaagccatcctggatgaaaccaaaggagactatgaaaaaatcctggtg
gctctgtgtggtggaaactag

DBGET integrated database retrieval system