KEGG   Mus musculus (mouse): 16956Help
Entry
16956             CDS       T01002                                 

Gene name
Lpl
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    16956 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    16956 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    16956 (Lpl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     16956 (Lpl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   16956 (Lpl)
  Exosomal proteins of breast milk
   16956 (Lpl)
Heparan sulfate/heparin binding proteins [BR:mmu00536]
 Enzymes (General comment) Variety
  16956 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 B3.3; 8 33.88 cM
AA seq 474 aa AA seqDB search
MESKALLLVVLGVWLQSLTAFRGGVAAADAGRDFSDIESKFALRTPEDTAEDTCHLIPGL
ADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH
YPVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTEDGKQHNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMMKLKWISDSYFSWPDW
WSSPSFVIERIRVKAGETQKKVIFCAREKVSHLQKGKDSAVFVKCHDKSLKKSG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggtcctgggagtttggctccagagtttgaccgcc
ttccgaggaggggtggccgcagcagacgcgggaagagatttctcagacatcgaaagcaaa
tttgccctaaggacccctgaagacacagctgaggacacttgtcatctcattcctggatta
gcagactctgtgtctaactgccacttcaaccacagcagcaagaccttcgtggtgatccat
ggatggacggtaacgggaatgtatgagagttgggtgcccaaacttgtggccgccctgtac
aagagagaacctgactccaatgtcattgtagtagactggttgtatcgggcccagcaacat
tatccagtgtcagctggctacaccaagctggtgggaaatgatgtggccagattcatcaac
tggatggaggaggagtttaactaccccctagacaacgtccacctcttagggtacagcctt
ggagcccatgctgctggcgtagcaggaagtctgaccaataagaaggtcaatagaattact
ggtttggatccagctgggcctaactttgagtatgcagaagcccccagtcgcctttctcct
gatgacgctgattttgtagatgtcttacacacatttaccagggggtcacctggtcgaagt
attggaatccagaaaccagtagggcatgttgacatttatcccaatggaggcactttccag
ccaggatgcaacattggagaagccatccgtgtgattgcagagagaggactcggagacgtg
gaccagctggtgaagtgctcgcacgagcgctccattcatctcttcattgactccctgctg
aatgaagaaaaccccagcaaggcatacaggtgcaactccaaggaagcctttgagaaaggg
ctctgcctgagttgtagaaagaatcgctgtaacaatctgggctatgagatcaacaaggtc
agagccaagagaagcagcaagatgtacctgaagactcgctctcagatgccctacaaagtg
ttccattaccaagtcaagattcacttttctgggactgaggatggcaagcaacacaaccag
gccttcgagatttctctgtacggcacagtggccgagagcgagaacattcccttcaccctg
cccgaggtttccacaaataaaacctactccttcttgatttacacggaggtggacatcgga
gaactgctcatgatgaagcttaagtggataagcgactcctacttcagctggcctgactgg
tggagcagccccagcttcgtcatcgagaggatccgagtgaaagccggagagactcagaaa
aaggtcatcttctgtgctagggagaaagtttctcatctgcagaagggaaaggactcagca
gtgtttgtgaaatgccatgacaagtctctgaagaagtctggctga

DBGET integrated database retrieval system