KEGG   Mus musculus (mouse): 16956Help
Entry
16956             CDS       T01002                                 

Gene name
Lpl
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    16956 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    16956 (Lpl)
  Digestive system
   04979 Cholesterol metabolism
    16956 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    16956 (Lpl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     16956 (Lpl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   16956 (Lpl)
  Exosomal proteins of breast milk
   16956 (Lpl)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   16956 (Lpl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  16956 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 B3.3; 8 33.88 cM
AA seq 474 aa AA seqDB search
MESKALLLVVLGVWLQSLTAFRGGVAAADAGRDFSDIESKFALRTPEDTAEDTCHLIPGL
ADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH
YPVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTEDGKQHNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMMKLKWISDSYFSWPDW
WSSPSFVIERIRVKAGETQKKVIFCAREKVSHLQKGKDSAVFVKCHDKSLKKSG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggtcctgggagtttggctccagagtttgaccgcc
ttccgaggaggggtggccgcagcagacgcgggaagagatttctcagacatcgaaagcaaa
tttgccctaaggacccctgaagacacagctgaggacacttgtcatctcattcctggatta
gcagactctgtgtctaactgccacttcaaccacagcagcaagaccttcgtggtgatccat
ggatggacggtaacgggaatgtatgagagttgggtgcccaaacttgtggccgccctgtac
aagagagaacctgactccaatgtcattgtagtagactggttgtatcgggcccagcaacat
tatccagtgtcagctggctacaccaagctggtgggaaatgatgtggccagattcatcaac
tggatggaggaggagtttaactaccccctagacaacgtccacctcttagggtacagcctt
ggagcccatgctgctggcgtagcaggaagtctgaccaataagaaggtcaatagaattact
ggtttggatccagctgggcctaactttgagtatgcagaagcccccagtcgcctttctcct
gatgacgctgattttgtagatgtcttacacacatttaccagggggtcacctggtcgaagt
attggaatccagaaaccagtagggcatgttgacatttatcccaatggaggcactttccag
ccaggatgcaacattggagaagccatccgtgtgattgcagagagaggactcggagacgtg
gaccagctggtgaagtgctcgcacgagcgctccattcatctcttcattgactccctgctg
aatgaagaaaaccccagcaaggcatacaggtgcaactccaaggaagcctttgagaaaggg
ctctgcctgagttgtagaaagaatcgctgtaacaatctgggctatgagatcaacaaggtc
agagccaagagaagcagcaagatgtacctgaagactcgctctcagatgccctacaaagtg
ttccattaccaagtcaagattcacttttctgggactgaggatggcaagcaacacaaccag
gccttcgagatttctctgtacggcacagtggccgagagcgagaacattcccttcaccctg
cccgaggtttccacaaataaaacctactccttcttgatttacacggaggtggacatcgga
gaactgctcatgatgaagcttaagtggataagcgactcctacttcagctggcctgactgg
tggagcagccccagcttcgtcatcgagaggatccgagtgaaagccggagagactcagaaa
aaggtcatcttctgtgctagggagaaagtttctcatctgcagaagggaaaggactcagca
gtgtttgtgaaatgccatgacaagtctctgaagaagtctggctga

DBGET integrated database retrieval system