KEGG   Mus musculus (mouse): 16987Help
Entry
16987             CDS       T01002                                 

Gene name
Lss, 2810025N20Rik, D10Ertd116e, Osc
Definition
(RefSeq) lanosterol synthase (EC:5.4.99.7)
  KO
K01852  
lanosterol synthase [EC:5.4.99.7]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    16987 (Lss)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.7  lanosterol synthase
     16987 (Lss)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10 39.1 cM
AA seq 733 aa AA seqDB search
MTEGTCLRRRGGPYKTEPATDLTRWRLQNELGRQRWTYYQAEDDPGREQTGLEAHSLGLD
TRSYFTDLPKAQTAHEGALNGVTFYAKLQAEDGHWAGDYGGPLFLLPGLLITCHISHISL
PAGYREEMVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVALRILGIGPDDPDLVRARNV
LHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPEWVPAHPSTLWCHCRQVYLP
MSYCYATRLSASEDPLVQSLRQELYVQDYASIDWPAQRNNVSPDEMYTPHSWLLHVVYGL
LNLYERFHSTSLRKWAVQMLYEHIAADDCFTKCISIGPISKTINMLVRWSVDGPSSPAFQ
EHVSRIKDYLWLGLDGMKMQGTNGSQIWDTSFAIQALLEAGAHHRPEFLPCLQKAHEFLR
LSQVPENCPDYQKYYRHMRKGGFSFSTLDCGWIVADCTAEGLKAVLLLQNQCPSITEHIP
RERLCDAVDVLLSLRNADGGFATYEKKRGGYLLELLNPSEVFGDIMIDYTYVECTSAVMQ
ALKHFHEHFPDYRAAEVRETLNQGLDFCRRKQRADGSWEGSWGVCFTYGTWFGLEAFACM
GHTYQDGAACAEVAQACNFLLSQQMADGGWGEDFESCEQRRYVQSARSQVHSTCWALMGL
MAVRHPDITAQERGIRCLLGKQLPNGDWPQENISGVFNKSCAISYTSYRNIFPIWALGRF
SNLYPDNTLAGHI
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgactgagggcacgtgtctgcggcgtcgtgggggaccctataaaactgagcccgccacc
gatctcacccgctggcggctccagaatgagttgggtcggcagagatggacttattatcaa
gcggaggacgaccctggtcgagagcagaccgggctagaggcccactctttgggactggac
acaagaagttatttcacggacttaccaaaagcgcaaacagcccatgagggggccctgaat
ggagtaaccttttatgccaagctgcaggctgaggatggacactgggctggtgattatggt
ggtccgctcttcctcttgccaggtctcctgattacctgtcacatatcacacatctctctg
ccagctggatacagagaggagatggtgcggtacctgcggtcagtgcagctccctgatggc
ggctggggcttgcacatcgaggacaagtccacagtgtttgggactgccctgaactatgtg
gctctcagaatcctgggtattgggcctgatgatcctgaccttgtgcgcgctcggaacgtc
cttcacaaaaaaggtggtgcggtggccatcccttcctgggggaagttctggctggctgtc
ctgaatgtttatagctgggaaggactcaacaccctattccctgagatgtggctgtttcct
gaatgggtaccagcgcacccctccactctctggtgtcactgccggcaggtctatctgccc
atgagttactgctacgccactcggctaagtgcctcagaggacccactggttcagagcctc
cgccaggaactctatgtgcaggattacgccagcatcgattggccagcgcagaggaacaac
gtgtcccccgatgagatgtacacgccacacagctggctgctgcatgtggtgtatggactc
ctcaacctgtatgaacgtttccatagcaccagcctgcggaagtgggccgtccagatgctg
tatgaacacattgcagctgatgactgtttcactaagtgcatcagcatcggcccgatctca
aagaccatcaacatgcttgttcgttggtcagtggatggaccatcctccccggccttccag
gagcacgtttctcggatcaaagattacctttggctgggccttgatggcatgaaaatgcag
ggcaccaatggatcacagatctgggacacttcatttgctatccaagcactgttagaggca
ggtgcacaccacagacctgagtttctgccctgcctgcagaaggctcacgagttcctgcgg
ctttcacaggttccagaaaactgtcctgactatcagaagtactatcgccatatgcgcaag
ggtggtttctccttcagcacactggactgtggctggatcgttgctgactgcacagccgag
ggtttgaaggctgtgctgctcctgcagaatcagtgtccgtccatcactgagcatatcccc
cgagagcggctgtgcgatgctgtggatgtgttactgagcttgaggaatgctgatggcggg
ttcgctacctatgagaagaagcgtgggggttacttgctggagctgctgaacccctcagag
gtctttggagacatcatgattgactacacgtatgtagagtgtacctccgctgtgatgcag
gcactgaagcatttccatgaacacttcccagactacagggcagcagaggtcagggagacc
ctcaatcaaggcctggacttctgccgaaggaagcagagagccgatggctcctgggagggc
tcctggggtgtttgtttcacctacggcacctggtttggcttggaagcgttcgcttgcatg
gggcatacctaccaagatggggctgcttgtgcagaagtagctcaggcctgcaacttcctc
ctgtcccagcagatggcggatggaggctggggagaggactttgaatcatgtgaacagcgg
cggtatgtgcagagtgctaggtcccaggtccatagcacctgctgggccctgatgggtttg
atggctgtcaggcatcccgacatcactgctcaggagagagggatcagatgtctgctaggg
aagcagttacccaatggagactggcctcaggagaacatctctggggtcttcaacaagtcc
tgtgccatcagctacacaagttacagaaacatcttccccatctgggccctgggccgcttc
tccaacctgtatcctgacaataccctcgccggccacatttga

DBGET integrated database retrieval system