KEGG   Mus musculus (mouse): 16993Help
Entry
16993             CDS       T01002                                 

Gene name
Lta4h
Definition
leukotriene A4 hydrolase (EC:3.3.2.6)
Orthology
K01254  
leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 C3
AA seq 611 aa AA seqDB search
MPEVADTCSLASPASVCRTQHLHLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDL
TIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNTIKTFGES
HPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSV
TTDDWKSFLYSHFKDKVDLLNQVDWNTWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAK
EEDLSSFSIADLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVHTYQEHKASMHPVT
AMLVGRDLKVD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggtcgcggatacttgctccttggcttctccagcctcggtctgccgaacccag
cacctccatcttcgctgcagcgtcgacttcgctcgccggacgctgaccgggacggccgcg
ctcacggtccagtcacaggaggagaatctgcgcagcctgactttggacacaaaagacctc
acaatagaaaaagtggtgatcaatggacaagaagtcaaatacacccttggagaaagtcaa
ggttacaaagggtcaccgatggaaatctctcttcccatcgccctgagcaaaaatcaagag
atcgttatagaaatttcctttgagacatctcccaaatcctctgcgcttcagtggctcact
cctgaacagacgtcagggaagcagcatccgtatctcttcagtcagtgccaggccatccac
tgcagggccatcctcccttgccaagacactccttccgtgaaattaacgtacaccgcagag
gtgtctgtcccgaaagaactggtggctctcatgagtgccatccgtgatggagaagcccct
gacccagaagaccccagcaggaagatttacagattcaaccagagggttcccataccatgc
tacctgattgctttggttgttggagctttagaaagcagacaaattggcccaagaactctg
gtgtggtccgagaaagagcaggtggagaaatctgctaatgaattttctgagaccgaatcc
atgcttaaaattgcagaagatctgggggggccctatgtttgggggcagtacgacctcttg
gttctgcccccatccttcccgtacggtggcatggagaacccttgtctcacgttcgtaacg
cctacgctactggcaggtgacaagtcactctccaacgttattgcacatgaaatatctcat
agctggacaggaaacctagtgactaacaagacgtgggatcacttttggttaaacgaagga
catactgtctacttagagcgccacatttgtggacggttgtttggggaaaagttcagacat
ttccatgctttgggaggatggggagagctacagaatacgataaaaacatttggggagtcc
caccccttcaccaagctcgtggttgatctgaaggacgtagaccccgatgtagcctattcc
tccatcccctatgagaagggctttgcgctactcttctaccttgaacagcttcttggggga
ccagaggtgtttctaggattcttaaaggcttatgttaagaagttttcctaccaaagtgta
acgactgatgactggaagagcttcctatattcccactttaaagacaaggtggatcttctc
aatcaagttgattggaacacctggctctacgctccgggcctgcctcctgtcaagcccaat
tacgacgtgactctgacaaatgcttgcattgccttaagtcaaagatgggttactgccaaa
gaggaagatttaagctcattcagcatcgcagacctgaaggatctctcgtcccatcagctg
aatgagttcctggcacaggtgcttcagaaggcacctcttcccttggggcacataaagcga
atgcaagaggtgtacaacttcaatgccattaacaattctgaaatacgattcagatggtta
cggctctgcattcaatcgaaatgggaggaagcaattcctttggccctaaagatggcaact
gaacaaggaaggatgaaattcacacgtcctctattcaaggatctcgctgccttcgacaaa
tcccatgatcaagctgtccacacctaccaagagcataaagccagcatgcatcccgtgact
gcgatgctggtggggagagatctgaaagtggattaa

DBGET integrated database retrieval system