KEGG   Mus musculus (mouse): 16993Help
Entry
16993             CDS       T01002                                 

Gene name
Lta4h
Definition
(RefSeq) leukotriene A4 hydrolase
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    16993 (Lta4h)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     16993 (Lta4h)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M1
   16993 (Lta4h)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C E1_DerP2_DerF2 DUF4367 Peptidase_M48
Motif
Other DBs
NCBI-GeneID: 16993
NCBI-ProteinID: NP_032543
MGI: 96836
Ensembl: ENSMUSG00000015889
Vega: OTTMUSG00000063908
UniProt: P24527
Position
10; 10 C2
AA seq 611 aa AA seqDB search
MPEVADTCSLASPASVCRTQHLHLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDL
TIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNTIKTFGES
HPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSV
TTDDWKSFLYSHFKDKVDLLNQVDWNTWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAK
EEDLSSFSIADLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVHTYQEHKASMHPVT
AMLVGRDLKVD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggtcgcggatacttgctccttggcttctccagcctcggtctgccgaacccag
cacctccatcttcgctgcagcgtcgacttcgctcgccggacgctgaccgggacggccgcg
ctcacggtccagtcacaggaggagaatctgcgcagcctgactttggacacaaaagacctc
acaatagaaaaagtggtgatcaatggacaagaagtcaaatacacccttggagaaagtcaa
ggttacaaagggtcaccgatggaaatctctcttcccatcgccctgagcaaaaatcaagag
atcgttatagaaatttcctttgagacatctcccaaatcctctgcgcttcagtggctcact
cctgaacagacgtcagggaagcagcatccgtatctcttcagtcagtgccaggccatccac
tgcagggccatcctcccttgccaagacactccttccgtgaaattaacgtacaccgcagag
gtgtctgtcccgaaagaactggtggctctcatgagtgccatccgtgatggagaagcccct
gacccagaagaccccagcaggaagatttacagattcaaccagagggttcccataccatgc
tacctgattgctttggttgttggagctttagaaagcagacaaattggcccaagaactctg
gtgtggtccgagaaagagcaggtggagaaatctgctaatgaattttctgagaccgaatcc
atgcttaaaattgcagaagatctgggggggccctatgtttgggggcagtacgacctcttg
gttctgcccccatccttcccgtacggtggcatggagaacccttgtctcacgttcgtaacg
cctacgctactggcaggtgacaagtcactctccaacgttattgcacatgaaatatctcat
agctggacaggaaacctagtgactaacaagacgtgggatcacttttggttaaacgaagga
catactgtctacttagagcgccacatttgtggacggttgtttggggaaaagttcagacat
ttccatgctttgggaggatggggagagctacagaatacgataaaaacatttggggagtcc
caccccttcaccaagctcgtggttgatctgaaggacgtagaccccgatgtagcctattcc
tccatcccctatgagaagggctttgcgctactcttctaccttgaacagcttcttggggga
ccagaggtgtttctaggattcttaaaggcttatgttaagaagttttcctaccaaagtgta
acgactgatgactggaagagcttcctatattcccactttaaagacaaggtggatcttctc
aatcaagttgattggaacacctggctctacgctccgggcctgcctcctgtcaagcccaat
tacgacgtgactctgacaaatgcttgcattgccttaagtcaaagatgggttactgccaaa
gaggaagatttaagctcattcagcatcgcagacctgaaggatctctcgtcccatcagctg
aatgagttcctggcacaggtgcttcagaaggcacctcttcccttggggcacataaagcga
atgcaagaggtgtacaacttcaatgccattaacaattctgaaatacgattcagatggtta
cggctctgcattcaatcgaaatgggaggaagcaattcctttggccctaaagatggcaact
gaacaaggaaggatgaaattcacacgtcctctattcaaggatctcgctgccttcgacaaa
tcccatgatcaagctgtccacacctaccaagagcataaagccagcatgcatcccgtgact
gcgatgctggtggggagagatctgaaagtggattaa

DBGET integrated database retrieval system