KEGG   Mus musculus (mouse): 17025Help
Entry
17025             CDS       T01002                                 

Gene name
Alad, ALADH, Lv
Definition
aminolevulinate, delta-, dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmu  Mus musculus (mouse)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    17025 (Alad)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     17025 (Alad)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   17025 (Alad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4 B3; 4 33.17 cM
AA seq 330 aa AA seqDB search
MHHQSVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQ
LEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACD
VCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKA
ALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVAR
DIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAV
LETMTAFRRAGADIIITYFAPQLLKWLKEE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaccagtctgttctgcacagcggctactttcacccactgcttcggagctggcag
actgctgcctccaccgtcagtgcctccaacctcatctatcccatctttgtcacggatgtt
cctgatgatgtccagcctatcgccagcctcccaggagtggccaggtatggcgtaaaccag
ctagaagagatgctgagacctctggtggaagctggcctgcgctgtgtcctgatctttggc
gtccccagcagagttcccaaggatgaacagggctctgcagctgactctgaggactcccca
actattgaggctgtccgtctgctgaggaagaccttcccttccctcctagtggcctgtgac
gtctgcttgtgcccctacacctcccatggccactgtggcctcctgagtgaaaatggagca
ttcctagcagaggagagccgacagcggttggcagaggtggcactggcctatgccaaggca
ggctgtcaggttgtagctccgtcagacatgatggacggacgagttgaggccatcaaggct
gccctgctaaaacatggacttggcaacagggtctctgtgatgagctatagtgccaaattt
gcctcctgtttctacggtcctttccgggatgcagctcagtcaagcccagcttttggagac
cgacgctgttatcagctgcctcctggtgcccgtggcctggccctccgagcagtggcccga
gacattcaagaaggagctgacatgctcatggtgaagccgggattgccctacctggacatg
gtgcgagaggtgaaggacaagcaccccgagctccccctcgcagtataccaggtgtctgga
gagtttgccatgttgtggcacggagcccaggccggggcctttgatctcaggactgctgta
ctggagaccatgacggccttccgcagagccggtgccgacatcatcatcacctactttgca
ccgcagctgttgaagtggctgaaggaagaatga

DBGET integrated database retrieval system