KEGG   Mus musculus (mouse): 17060Help
Entry
17060             CDS       T01002                                 

Gene name
Blnk, BASH, Bca, Ly-57, Ly57, Lyw-57, SLP-65
Definition
(RefSeq) B cell linker
  KO
K07371  B-cell linker protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    17060 (Blnk)
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    17060 (Blnk)
  Development
   04380 Osteoclast differentiation
    17060 (Blnk)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    17060 (Blnk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2
Motif
Other DBs
NCBI-GeneID: 17060
NCBI-ProteinID: NP_032554
MGI: 96878
Ensembl: ENSMUSG00000061132
Vega: OTTMUSG00000031860
UniProt: Q9QUN3
Structure
PDB: 

Jmol
Position
19 C3; 19 34.26 cM
AA seq 457 aa AA seqDB search
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMDKIKKLKVKGPPSVPRRDYALDSPADE
EEQWSDDFDSDYENPDEHSDSEMYVMPAEETGDDSYEPPPAEQQTRVVHPALPFTRGEYV
DNRSSQRHSPPFSKTLPSKPSWPSAKARLASTLPAPNSLQKPQVPPKPKDLLEDEADYVV
PVEDNDENYIHPRESSPPPAEKAPMVNRSTKPNSSSKHMSPPGTVAGRNSGVWDSKSSLP
AAPSPLPRAGKKPATPLKTTPVPPLPNASNVCEEKPVPAERHRGSSHRQDTVQSPVFPPT
QKPVHQKPVPLPRFPEAGSPAADGPFHSFPFNSTFADQEAELLGKPWYAGACDRKSAEEA
LHRSNKDGSFLIRKSSGHDSKQPYTLVAFFNKRVYNIPVRFIEATKQYALGKKKNGEEYF
GSVVEIVNSHQHNPLVLIDSQNNTKDSTRLKYAVKVS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgaataagataactgtccctgccagccagaagctgagacagcttcaaaag
atggtccatgatattaagaacaatgaaggtggaataatggacaagataaaaaagctaaaa
gtcaaaggccctccaagtgttcctcgaagggactacgcattagacagccctgcagatgaa
gaggagcagtggtcagatgacttcgacagtgactatgaaaatccagatgaacattcggac
tccgagatgtatgtgatgcctgccgaggagacgggcgacgattcctatgaaccgcctccc
gctgagcagcagacacgggtggtccatccagccctgcccttcacgaggggcgagtatgta
gataatcgatccagccagcggcactctccgcccttcagcaagacacttcccagtaagccc
agctggccttcagcgaaagcgaggctggcctccactctgccagcccccaactctctacag
aagcctcaagtcccccccaagcccaaagacctccttgaggatgaggctgattatgtggtc
cctgtggaagataacgatgaaaactatatccatcccagagaaagcagcccgccgcctgct
gagaaggctcccatggtgaatagatcaaccaagccaaacagttcctcaaagcacatgtcg
cctccagggactgtcgcaggtcgaaacagtggggtctgggactccaagtcatctttgcct
gccgcaccatccccactaccacgggctgggaagaagccagctacaccacttaagactact
cccgttcctcccctaccgaatgcatcaaatgtttgtgaagaaaagcctgttcctgctgag
cgccaccgagggtctagtcacagacaagacactgtacagtcaccagtgtttcctcccacc
cagaaacctgtccatcaaaagcctgtacccttgccaaggttcccagaagcggggagccca
gctgcagatggaccgttccacagcttcccatttaattcgacgtttgcagaccaggaggct
gaactgctcggtaagccctggtatgctggcgcctgtgaccgcaagtctgctgaagaggcc
ttgcacagatccaacaaggatggatcgtttcttattcggaagagctctggccatgattcc
aagcagccgtacaccctagttgcgttctttaacaagcgagtgtataatattcctgtacgg
tttattgaagcaaccaaacagtatgctttgggaaagaagaaaaatggtgaagagtacttc
ggaagtgttgtggaaatcgtcaacagtcaccagcacaaccccctggttcttattgacagt
cagaataacacgaaagattccacgagactgaaatatgctgtgaaggtttcataa

DBGET integrated database retrieval system