KEGG   Mus musculus (mouse): 170677Help
Entry
170677            CDS       T01002                                 

Gene name
Cdhr1, Pcdh21, Prcad, mKIAA1775
Definition
cadherin-related family member 1
Orthology
K16501  
cadherin-related family member 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 B; 14
AA seq 859 aa AA seqDB search
MRRGPRVALVLGLLRIYLAQANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGT
DPEGDPISYHISFDPSTRSVFSVDPNFGNITLVEELDREREDEIEAIISISDGLNLVAEK
VVILVTDANDEAPRFIQEPYIIRVPENIPAGSSIFKVQAEDKDTGSGGSVTYSLQNLHSS
KFSMDRHSGVLRLQAGATLDYEKSRAHYITVIAKDGGGRLRGADMVFSATTTVTINVEDV
QDTAPIFVGTPYYGYVYEDTLPGSEVLTVVAIDGDRGKPNHILYRLLNESDGIFEINETS
GAISVLQSPALLRREVYELHVQVTEVNSPGSPAAQATVPVTIRIVDLNNHPPTFYGESGP
QNKFELSMFEHPPQGEILRGLKITVNDSDQGANAKFNLRLVGPGGIFRVVPQTVLNEAQV
TIIVENSAAIDFEKSKLLTFKLLAIEVNTPEKFSSTADIVIQLLDTNDNVPKFTSHYYIA
RIPENAPGGSNVVAVTAVDPDTGPWGKVHYSIYGTGSDLFLIHPSTGLIYTQPWASLDAE
GTSRYNFYVKAEDMDGRYSLAEVFVTLLDVNDHYPQFVQSVQEKTMVLGTPLKIEATDQD
AEEPNNLVDYSITRAEPVNVFDIDAHTGEIRLKNSIRSLEALHNITPSGDYSWSLQVQAK
DRGSPSFSTTALLKIDITDTERLSRGSMAAFLIQTKDNPMKAVGVLAGVMAIVVAITVLI
STATFWRNKKSNKVLPVRRVLRRRPSPAPHTVRIEWLKFRRAKAATKFILKEDSPNENCN
NSRVGVMVPPRAPALPPPPKMASSMVAQQTVPTVSGSLTPQPSPQLPTPKTLGGPVQSSL
VSELKQKFEKKSLDNKAYI
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtggcccacgggtcgccctggtcctggggctgctgcgcatttacctagcccag
gccaactttgcccctcacttctttgacaatggagtgggcagcaccaacgggaacatggcc
ctgttcagcctcccagaagacactcctgtaggttctcatgtgtacaccctaaatgggaca
gaccctgagggagaccctatctcctaccacatcagctttgaccccagcactagaagtgtc
ttttctgttgatcccaattttggaaacatcactctggtggaagagctggacagagaaagg
gaagatgagattgaagccatcatcagcatttccgatggcctgaacctggtggcagagaaa
gtcgtgatactggtgacagatgccaatgatgaagcacccaggttcatccaggagccttac
atcatccgggttccagagaacatacctgctgggagcagcatctttaaggtccaggcagag
gacaaggacacaggctctggaggcagtgtcacctactcccttcagaacctacactcctcc
aagttctccatggaccgtcacagcggggtgctgagactccaggctggggccacactggac
tatgagaagtcgagggctcattacatcactgtgattgccaaggatggtgggggcaggctt
cgaggggctgacatggtgttctcagccaccaccaccgtcaccatcaatgtggaagatgtt
caggacacggcccctatcttcgtgggtacaccctactatggttacgtgtatgaagacacc
cttcctggctcagaggtgctgacggtggttgccatagatggagaccgaggcaaacccaac
cacatcctctacaggctcttgaatgagagtgacggaatctttgaaattaatgagacatct
ggagccatctccgtccttcagagccctgccctgctccgaagagaggtgtatgaacttcat
gtacaggtgacagaggtcaactctccaggaagcccagctgctcaggccacagtcccagtg
accatcaggatcgtggacctcaacaaccaccctccaaccttctatggagagagtgggccc
cagaacaagtttgagctctctatgtttgagcacccaccccagggggagattctccgtgga
ctcaagatcactgtcaacgactcagaccagggagccaatgccaaattcaacttacggctg
gtgggacctggaggcatcttccgagtggtgccacagaccgtcctgaatgaagcccaagtg
accatcatagtggaaaactcagctgccattgactttgaaaagtctaagttgttgaccttc
aagctcctggccattgaagtgaacaccccagagaagttcagttccacagcagacattgtg
atccagcttctggacaccaatgataatgtccccaagttcacctcgcactactacattgcc
aggatcccagagaatgctccaggaggctccaacgtggtggctgtcacagctgtggatcca
gatacaggaccatggggcaaagtccactattccatctatgggaccgggtcagacctgttc
ttaattcacccatccactgggcttatctacactcagccctgggccagcctggatgctgag
ggtacttcgaggtacaacttttatgtgaaggcagaagacatggatggaaggtacagcctg
gctgaggtgtttgtcactctcttggatgtcaatgaccactacccccagtttgtacagagc
gtccaggaaaagacaatggtactggggaccccactgaaaattgaggcaacagaccaggat
gcagaggagcctaacaacttggtagactactccattacccgtgcagagccagtcaacgtg
tttgacattgatgcacacacaggggaaattaggctcaagaattccatccgctccttggag
gccctacacaacatcacacccagtggggactactcatggtccctacaggtgcaggccaag
gaccgaggctccccatctttcagtacaacagccttactcaagatcgacatcacagataca
gagaggctatccagaggttccatggctgccttcctgattcagaccaaggacaatcccatg
aaagccgtaggtgtactggctggtgtcatggcaattgttgtggccataactgtcctcatc
tccacggctaccttctggcgtaacaagaagtctaacaaggtcctgcctgtgcggcgtgtg
ctccgtagaaggcccagccctgctccccacacagttcgaatagagtggctcaaattcagg
agggccaaggctgctaccaagtttatactcaaagaggattctcccaatgagaactgcaat
aacagcagagtgggagtcatggtgcccccaagagctccagctctcccaccaccccctaaa
atggcatccagtatggtggcccaacagacagtgcctactgtctctggatccctcacccca
cagccatccccacagttacccacacccaagaccctgggaggccccgttcagtcttctttg
gtgtctgagctcaagcaaaagtttgagaagaagagtttagacaacaaggcctatatctag

DBGET integrated database retrieval system