KEGG   Mus musculus (mouse): 170707Help
Entry
170707            CDS       T01002                                 

Gene name
Usp48, 2810449C13Rik, AI115503, BC021769, D330022K21Rik, Usp31
Definition
ubiquitin specific peptidase 48 (EC:3.4.19.12)
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     170707 (Usp48)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   170707 (Usp48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D3; 4
AA seq 1052 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGE
HIWLGEIDENSFHSIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYTKGDGIHGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCNQCGRESKLVSKFYELE
LNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNAYIGFSESLDMEPYVEHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLEPSKSQTRKPKCGKGTHCSRNAYMLVYRLQ
AQEKNHTMVQVPAFLQELVDRDNSKFEEWCVEMAEMRKQSVDKGKAKHEEVKELYQRLPA
GAEPYEFVSLEWLQKWLDESTPTKPIDNNACLCSHDKLHPDKISIMKRISEYAANIFYSR
YGGGPRLTVKALCKDCVVERCRVLRLKNQLNEDYKAVNNLLKSTMKGDGFWVGKSSLRSW
RQLALEQLDEQDGEAEQSNGKINGSTFNKDESKEEKKEEEEELNFNEDILCPHGELSISE
NERRLVSQEAWSKLQQYFPKAPEFPSYRECCSQCKILEREGEENEALHKMIANEQKTSLP
NLFQDKNRPCLSNWPEDTDALYIVSHFFLDEWRKFVRKPARSAPVSSIGNAALLCPHGGL
MFTFPSLTKEDSKLCQPLERREGGWPTAAHNNIALIWPSEWQMIQKLFVVDKVIKITRIE
VGDVNPSQTQYISEPSLCPDCREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPEL
NVSSSETEEDKEEAKPDGEKDPDFNQSNGSTKRQKTSQQGYVAYQKQVIRRSTRHRKVRG
EKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILNDDCATLGTLGVIPESVILLK
ADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcctaccgcatctggctggagccttgtatc
cgaggcgtgtgcagaagaaactgcagaggaaacccgaattgcttggttggcattggcgag
cacatttggttaggagagatagatgagaatagttttcatagcattgatgatcccaactgt
gagaggaggaaaaagaattcctttgtgggcttgactaacctgggagccacctgctacgtc
aacacctttctccaggtgtggttcctcaacttggagcttcggcaggcgctgtacttatgc
cccagcacctgcagtgattacacgaagggagatgggatccatgggggaaaagattatgag
cctcagacaatttgtgagcatcttcagtacttgtttgctttgttgcaaaacagtaacaga
cgatacatcgatccttcaggatttgttaaagccttgggcttagatactgggcagcagcag
gatgcacaagagttttccaagctctttatgtcgctgttggaagacactttgtctaaacag
aagaacccggatgttcggaatgttgtgcagcagcagttctgtggagaatatgcctatgtg
actgtgtgcaatcagtgtggccgagagtctaagcttgtatcgaagttctatgaactggag
ttaaacatccaaggccacaagcagttaacagactgcatctcagagttcctgaaggaagaa
cgattagaaggagacaatcgatacttctgtgaaaactgtcagagcaaacagaatgctaca
cggaaaatccggcttctgagcctcccttgcactctgaacttgcagctgatgcgtttcgtg
tttgacaggcaaactggacacaagaagaagctcaatgcatacatcggcttctcagagagt
ctagatatggagccttacgtggagcacaaaggcgggtccttcgtgtacgagctcagtgcc
gtcctcatccacagaggagtcagcgcctattctggccactacatcgcacacgtgaaagac
cctcagtctggagaatggtacaagttcaatgacgaggacatagagaagatggagggcaag
aagctacagctagggattgaggaagatctagaaccttctaaatcccagacccgtaaaccc
aagtgtggcaaaggaactcactgctcccgaaatgcatacatgctggtttataggctgcaa
gcccaggaaaagaaccacacaatggttcaagtcccagcctttcttcaagagctggtagat
cgtgataattccaaattcgaggagtggtgtgtagaaatggccgagatgcgcaagcagagt
gtggacaaaggcaaagcgaagcacgaggaggtgaaggagctgtaccaaaggttgcctgct
ggagctgagccctatgagtttgtctctcttgaatggctgcagaagtggttggacgagtca
acacccaccaaaccgattgataataatgcttgcctgtgttcccacgacaagcttcatcct
gataaaatatcaattatgaagagaatatcggaatatgcggctaacattttctatagtcga
tatggaggaggtccaagactaactgtgaaagccctttgtaaggactgcgtcgtggaacgc
tgccgtgtcctgcgcctgaagaatcagctgaatgaagattacaaagctgtcaacaatttg
ctgaaatcgacaatgaagggtgatggattttgggtaggaaagtcttccttgcgtagctgg
cgccagctggctcttgaacaactagatgagcaagatggtgaggcggagcaaagcaacggg
aagataaacgggagcaccttcaataaagatgaatcaaaggaagaaaagaaagaagaggag
gaggaattaaattttaatgaagacattctgtgtcctcatggagagttaagcatatctgaa
aatgaaagaaggctggtttctcaggaggcttggagcaagctgcagcagtacttcccaaag
gctcccgagttcccaagttacagagagtgctgctcgcagtgcaagatactagaacgagaa
ggtgaagaaaacgaagccttgcataagatgatagcaaacgagcagaagacctcacttcca
aacttgttccaggacaaaaacagaccatgtctcagtaactggccagaggacacggatgct
ctctatattgtgtcgcacttctttttagatgaatggcggaaatttgttagaaagcctgca
aggtctgctcctgtgtcgtcaattgggaatgctgcccttctgtgtccacatggaggactc
atgtttacatttccttccctcaccaaagaagactcgaaactctgtcaacctttagagaga
agagaaggaggctggcccactgcagcacataataatatagctctcatatggcccagcgaa
tggcaaatgattcaaaagctctttgttgtggataaagtaattaaaatcacaagaattgaa
gtgggagacgtgaatccttctcaaacacagtatatttctgaacctagtctctgtccagat
tgcagagaaggtctgctgtgccagcagcagagggaccttcgagagtatacccaagccacc
atctatgtccacaaggttgtggataacaaaaaggtgatgaaggactcggcccccgagttg
aatgtgagtagttctgagacggaagaagacaaggaggaggctaagccagatggggagaag
gatcctgactttaatcaaagcaatggaagtaccaagcgacagaagacatcccaacagggc
tatgtggcctaccagaagcaggtcatccggaggagcacgaggcacaggaaggttcgggga
gagaaggcactgttggtgtctgccaaccagacgttaaaagaattgaagattcagatcatg
cacgcattttcagttgctccatttgaccagaatttgtcaattgatggaaagattttaaac
gacgactgtgccacccttggtaccctcggcgtcattcctgagtctgtcattttgttaaag
gctgatgaaccaattgcagactacgctgcaatggatgatgtcatgcaagtttgtatgccg
gaagagggctttaaaggtacgggcctgctcggacattaa

DBGET integrated database retrieval system