KEGG   Mus musculus (mouse): 170720Help
Entry
170720            CDS       T01002                                 

Gene name
Card14, Bimp2, CARMA2
Definition
(RefSeq) caspase recruitment domain family, member 14
  KO
K20913  
caspase recruitment domain-containing protein 14
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    170720 (Card14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E2
AA seq 999 aa AA seqDB search
MAELCRMDSTLTALDEEMLWDMLESHRCRIVQSICPSRLTPYLRQAKVLGQLDEEEILHS
SRFTNSAMRVGHLLDLLKARGKNGAIAFLESLKFHNPDVYTLVTGLQSDIDFSTFSGLME
TSKLTECLAGAISSLQEELAQEKAQKEVLLRRCQQLKERLGLAEAHAEGLRQLEVDHSRM
KREVSTHFHEVLKLKDEMLNLSLHYSNALREKELAATRCHSLQEELYLVKQELQRASLVS
SCERESRERSLKMASNLEPQGEELNRLKEENEKLRSMTFSLVEKDILEQSLDEARESKQE
LVDRIHSLRERAVAAERQQKQYWEEKEQTLLQFRKTQVDCELYKEKMTMLQGQVAELQKE
RDQAYTARDRAQMEISQRLVEKDALRRRVFELTEQVCELRTQLRRLQAEAPGGPKQEAGA
RELCLRGKQRLVRMHAVCPPDDSDCSLLSSTESRLWWDLNSTSSREQMDSFRSSSPMPPS
QQSLYKRVAEDFLEDPESLSFPEVLEMRLQGATVDDTDTDLEFEMIDGADLSQTEDSLQG
SSRSLNVSESSVPVRRRPARKILSQVTVLAFQGDALLEQIGVIGGNLTGIFIHRVTPGSA
ADEMALRPGTQIMMVDYKPTKPSLRATLENTTLEQAVGLLRRVNGSCYLSVKINTEGYKN
LIQDLDAKVVTSGDSFYIRVNLAMQRGGDGELQTHCNDILHVTDTMFQGRSCWHAHHVNP
YTMKDMEPGTIPNYSQAQQQLLALIQDMTQRCTVPRKPPGGPQKLVRIVSVDKAAVSPLT
SSFDQSQWDSGKEEGGPSVCFWSESCFTLAPYTLVHPHRPARPRPVLFVPRLVGRILGKK
LCLLQGFKQCSAEYLSQEEYATWSQRGDIIQEGESIGDHHWITRHAVESLMNMSTHALLD
VRLDSVRVLHRMDMFPIIIHVSVNEKTAKKLRKGLHRLGSSEEQFLEVARQEEGELDRVP
CLYSSLAPDSWSDLDSLLSCVRLAIADEQKKVVWTESPC
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactgtgccgcatggattccacactgactgctctggacgaggagatgctctgg
gatatgctggagagtcaccgatgcaggattgtgcagagcatctgccctagccggctcacc
ccctacctgcgccaggccaaggtgctgggccagctggacgaggaggagatcctgcatagc
tcccgtttcaccaacagtgccatgagagttgggcacttgctggatctgctaaaggcccga
gggaagaatggagccattgcctttctggaaagcctgaagttccacaaccctgatgtctac
accctggtcactgggctgcagtctgacattgacttcagcactttcagcggtctcatggag
acatccaagctgaccgagtgtctggctggggccatcagcagcctgcaggaggagctggcc
caggagaaggcacagaaggaggttctgctccggagatgccagcagctgaaggagcgcctg
ggcttggctgaggctcacgcagaaggtctgcgccagctggaggtcgaccacagccgcatg
aaacgtgaggtcagcacccacttccacgaggtcctgaaactgaaggacgagatgctgaac
ctgtcactgcactacagcaacgcactcagagagaaggagctggctgccacacgctgccac
agccttcaggaagagctctacctggtgaagcaggaactccagcgagcaagccttgtatcg
tcatgtgaaagagaatctcgagagaggtccctgaagatggccagcaacctggagcctcag
ggagaagaactaaatcggcttaaggaggagaatgagaaactccgctccatgaccttcagc
ctggtggagaaggacattctggaacagagtctggatgaggccagggagagcaagcaagag
ctggtggaccgcatccactcactgcgggagagagcagtggccgcggagaggcagcagaag
cagtactgggaggagaaggaacagaccctactccagttccggaagacacaggtggactgt
gaactatacaaagaaaagatgaccatgcttcagggccaggtggctgagctgcagaaggaa
cgtgaccaggcatacacagcaagggacagggcccagatggagatttctcagcgcctggtg
gagaaggatgcccttcgcaggagagtgttcgagctgacggagcaggtctgtgagctgcgt
actcagctgcgcaggctgcaggcggaggccccaggaggacccaagcaggaagccggagcc
agggaactctgcctccgggggaagcagaggcttgtgcggatgcatgctgtgtgcccacca
gatgacagtgactgcagcctcctcagctccacagagtcccggctgtggtgggacctgaat
tccacatccagccgggagcagatggacagcttccgctccagcagccccatgcctcccagc
cagcagtccctgtacaagcgggtggcagaggacttcctggaagaccccgagtctctaagc
ttcccagaagtccttgagatgcgccttcaaggggctacagtggacgacacagacacagac
ctggagtttgagatgattgacggagcagacctctctcagacagaagacagcctgcagggg
tcttcccggagcctgaatgtctcagaaagcagtgtccccgtgaggaggaggccagcccgc
aagatcctaagccaggtcacggtgctggcgttccaaggggacgcgttgctggaacagatt
ggtgtcatcggtgggaacctcactgggatcttcattcaccgtgtcacccccggctctgca
gcagatgagatggccctgcgccctggtacccagatcatgatggtggactataaacctacc
aagccatcattaagggccactctggagaatacaacgctggagcaggctgtgggccttctc
aggagggtgaatggctcctgctacttgtctgtgaagatcaacactgaaggttataagaac
ctcatccaggacctagatgccaaagtggtaacgtctggggattccttctacatccgtgtc
aacctggccatgcagaggggaggggacggagaactgcaaactcactgcaatgacatcctg
catgtcactgacaccatgttccaaggccgcagctgctggcatgcccaccatgtgaacccc
tacaccatgaaagacatggagcctggcaccatccccaactattcacaggctcagcagcag
cttctggccctcatccaggacatgactcaacggtgcacagtcccccgcaagcctcctgga
ggaccacagaagttagtacgaattgtcagtgtggacaaagccgctgtcagtcctctgact
tcatcctttgaccaaagccagtgggattctggcaaggaggaaggtggtcctagcgtgtgc
ttctggtcagagagctgcttcaccctggcaccgtacaccctggtgcacccccacaggcct
gcccggccccggcctgtgctgtttgtgcctagattagttggaaggatcctgggtaaaaag
ctgtgtctcctccaaggttttaagcaatgttcagcagagtacttgagccaggaggagtat
gccacctggagtcagagaggggacatcatccaggagggagagtcaataggtgaccaccac
tggatcacccggcatgctgtggagtccctcatgaatatgagcacccacgccctgctggat
gtgcggctggacagcgtccgagtcctacataggatggacatgtttcccattatcatccat
gtctctgtcaatgagaagacagcaaagaaactcaggaagggcctgcatcggcttggcagc
tcggaggagcagttcctggaggtggcccggcaggaggagggagagctggacagagtgccg
tgtctgtacagcagcctggcccccgacagctggagtgatctggacagcctgctcagctgt
gtgcgcctggccattgcagatgagcagaagaaggtggtgtggacagagagcccctgctga

DBGET integrated database retrieval system