KEGG   Mus musculus (mouse): 170743Help
Entry
170743            CDS       T01002                                 

Gene name
Tlr7
Definition
(RefSeq) toll-like receptor 7
  KO
K05404  
toll-like receptor 7
Organism
mmu  Mus musculus (mouse)
Pathway
Toll-like receptor signaling pathway
Measles
Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    170743 (Tlr7)
 Human Diseases
  Infectious diseases
   05162 Measles
    170743 (Tlr7)
   05164 Influenza A
    170743 (Tlr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X F5
AA seq 1050 aa AA seqDB search
MVFSMWTRKRQILIFLNMLLVSRVFGFRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIP
EGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRP
GSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLG
QNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKI
QENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSN
SLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFSFNYELQVYHASI
TLPHSLSSLENLKILRVKGYVFKELKNSSLSVLHKLPRLEVLDLGTNFIKIADLNIFKHF
ENLKLIDLSVNKISPSEESREVGFCPNAQTSVDRHGPQVLEALHYFRYDEYARSCRFKNK
EPPSFLPLNADCHIYGQTLDLSRNNIFFIKPSDFQHLSFLKCLNLSGNTIGQTLNGSELW
PLRELRYLDFSNNRLDLLYSTAFEELQSLEVLDLSSNSHYFQAEGITHMLNFTKKLRLLD
KLMMNDNDISTSASRTMESDSLRILEFRGNHLDVLWRAGDNRYLDFFKNLFNLEVLDISR
NSLNSLPPEVFEGMPPNLKNLSLAKNGLKSFFWDRLQLLKHLEILDLSHNQLTKVPERLA
NCSKSLTTLILKHNQIRQLTKYFLEDALQLRYLDISSNKIQVIQKTSFPENVLNNLEMLV
LHHNRFLCNCDAVWFVWWVNHTDVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTN
LILFSVSISSVLFLMVVMTTSHLFFWDMWYIYYFWKAKIKGYQHLQSMESCYDAFIVYDT
KNSAVTEWVLQELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTQ
KYAKTESFKMAFYLSHQRLLDEKVDVIILIFLEKPLQKSKFLQLRKRLCRSSVLEWPANP
QAHPYFWQCLKNALTTDNHVAYSQMFKETV
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggtgttttcgatgtggacacggaagagacaaattttgatctttttaaatatgctctta
gtttctagagtctttgggtttcgatggtttcctaaaactctaccttgtgaagttaaagta
aatatcccagaggcccatgtgatcgtggactgcacagacaagcatttgacagaaatccct
gagggcattcccactaacaccaccaatcttacccttaccatcaaccacataccaagcatc
tctccagattccttccgtaggctgaaccatctggaagaaatcgatttaagatgcaattgt
gtacctgttctactggggtccaaagccaatgtgtgtaccaagaggctgcagattagacct
ggaagctttagtggactctctgacttaaaagccctttacctggatggaaaccaacttctg
gagataccacaggatctgccatccagcttacatcttctgagccttgaggctaacaacatc
ttctccatcacgaaggagaatctaacagaactggtcaacattgaaacactctacctgggt
caaaactgttattatcgaaatccttgcaatgtttcctattctattgaaaaagatgctttc
ctagttatgagaaatttgaaggttctctcactaaaagataacaatgtcacagctgtcccc
accactttgccacctaatttactagagctctatctttataacaatatcattaagaaaatc
caagaaaatgattttaataacctcaatgagttgcaagttcttgacctaagtggaaattgc
cctcgatgttataatgtcccatatccgtgtacaccgtgtgaaaataattcccccttacag
atccatgacaatgctttcaattcattgacagaattaaaagttttacgtttacacagtaat
tctcttcagcatgtgcccccaacatggtttaaaaacatgagaaacctccaggaactagac
ctctcccaaaactacttggccagagaaattgaggaggccaaatttttgcattttcttccc
aaccttgttgagttggatttttctttcaattatgagctgcaggtctaccatgcatctata
actttaccacattcactctcttcattggaaaacttgaaaattctgcgtgtcaaggggtat
gtctttaaagagctgaaaaactccagtctttctgtattgcacaagcttcccaggctggaa
gttcttgaccttggcactaacttcataaaaattgctgacctcaacatattcaaacatttt
gaaaacctcaaactcatagacctttcagtgaataagatatctccttcagaagagtcaaga
gaagttggcttttgtcctaatgctcaaacttctgtagaccgtcatgggccccaggtcctt
gaggccttacactatttccgatacgatgaatatgcacggagctgcaggttcaaaaacaaa
gagccaccttctttcttgcctttgaatgcagactgccacatatatgggcagaccttagac
ttaagtagaaataacatattttttattaaaccttctgattttcagcatctttcattcctc
aaatgcctcaacttatcaggaaacaccattggccaaactcttaatggcagtgaactctgg
ccgttgagagagttgcggtacttagacttctccaacaaccggcttgatttactctactca
acagcctttgaagagctccagagtcttgaagttctggatctaagtagtaacagccactat
tttcaagcagaaggaattactcacatgctaaactttaccaagaaattacggcttctggac
aaactcatgatgaatgataatgacatctctacttcggccagcaggaccatggaaagtgac
tctcttcgaattctggagttcagaggcaaccatttagatgttctatggagagccggtgat
aacagatacttggacttcttcaagaatttgttcaatttagaggtattagatatctccaga
aattccctgaattccttgcctcctgaggtttttgagggtatgccgccaaatctaaagaat
ctctccttggccaaaaatgggctcaaatctttcttttgggacagactccagttactgaag
catttggaaattttggacctcagccataaccagctgacaaaagtacctgagagattggcc
aactgttccaaaagtctcacaacactgattcttaagcataatcaaatcaggcaattgaca
aaatattttctagaagatgctttgcaattgcgctatctagacatcagttcaaataaaatc
caggtcattcagaagactagcttcccagaaaatgtcctcaacaatctggagatgttggtt
ttacatcacaatcgctttctttgcaactgtgatgctgtgtggtttgtctggtgggttaac
catacagatgttactattccatacctggccactgatgtgacttgtgtaggtccaggagca
cacaaaggtcaaagtgtcatatcccttgatctgtatacgtgtgagttagatctcacaaac
ctgattctgttctcagtttccatatcatcagtcctctttcttatggtagttatgacaaca
agtcacctctttttctgggatatgtggtacatttattatttttggaaagcaaagataaag
gggtatcagcatctgcaatccatggagtcttgttatgatgcttttattgtgtatgacact
aaaaactcagctgtgacagaatgggttttgcaggagctggtggcaaaattggaagatcca
agagaaaaacacttcaatttgtgtctagaagaaagagactggctaccaggacagccagtt
ctagaaaacctttcccagagcatacagctcagcaaaaagacagtgtttgtgatgacacag
aaatatgctaagactgagagttttaagatggcattttatttgtctcatcagaggctcctg
gatgaaaaagtggatgtgattatcttgatattcttggaaaagcctcttcagaagtctaag
tttcttcagctcaggaagagactctgcaggagctctgtccttgagtggcctgcaaatcca
caggctcacccatacttctggcagtgcctgaaaaatgccctgaccacagacaatcatgtg
gcttatagtcaaatgttcaaggaaacagtctag

DBGET integrated database retrieval system