KEGG   Mus musculus (mouse): 170762Help
Entry
170762            CDS       T01002                                 

Gene name
Nup155, D930027M19Rik, mKIAA0791
Definition
(RefSeq) nucleoporin 155
  KO
K14312  
nuclear pore complex protein Nup155
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    170762 (Nup155)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     170762 (Nup155)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15; 15 A2
AA seq 1391 aa AA seqDB search
MPSVLGSMMVASTSAAASLQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGM
SDMDYPLQGPGLLSVPSLPEISTIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTID
SDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSY
ANVQTGSGILNDSMCGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVI
QVYDLGHDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIESSESLDCQLLA
VTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLM
TASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFK
LHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPATLPTPSNVGPILGS
PMYSSSPVPSGSPYPNPSSLGTPSHGAQPPTMSTPMCAVGSPAMQAASMSGLTGPEIVYS
GKHNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPVQLLESVLQELKGLQEF
LDRNSQFSGGPLGNPNTTARVQQRLVGFMRPENGNTQQMQQELQRKFQEAQLSEKISLQA
IQQLVRKSYQALALWKLLCEHQFSVIVGELQKEFQEQLKITTFKDLVIRDKEVTGALIAS
LINCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQSKTERERMLRES
LKEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVV
GLQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHF
EQMLKLAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMARVDQNRVRYMDL
LWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEF
LHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAE
CKLAVIHCAGYSDPILVHTLWQDIIEKELNDSVALSSSDRMHALSLKLVLLGKIYAGTPR
FFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRVKSP
LHLLDCIHVLLTRYVENPSLVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNF
KSLQAKLERLH
NT seq 4176 nt NT seq  +upstreamnt  +downstreamnt
atgccatcggtgctgggctctatgatggtggcctctacgtcggccgccgcctccctgcag
gaagctttggaaaacgcggggaggcttatcgatcgacagttgcaagaagaccgcatgtac
ccggacctttctgagctgctcatggtgtcggccccaaacagtcctactgtttctggaatg
tccgacatggattaccctctgcaaggaccaggtttgctgtcagtacccagccttccagag
atcagcactatccggagagttcccctcccgcctgagctggttgaacagtttggacacatg
cagtgcaactgcatgatgggcgttttccccccgatcagcagagcctggcttacgattgac
agtgacatattcatgtggaactatgaagatggaggtgaccttgcctattttgatggactc
agtgagacaattcttgctgtggggcttgtgaaaccaaaagctggcatctttcaacctcat
gtaagacacttgctggttttggcaacccctgtggatatagtaattcttggactcagctat
gctaatgtacaaacaggttctggcattctcaatgacagcatgtgtggcggcatgcagctg
cttccagatcccttatattctcttcccacggacaacacgtaccttttaacaatcacgtcc
acggataatggcagaatctttctggctggaaaggatggctgtttgtacgaagtagcatac
caagcagaagcaggctggttcagtcaaagatgtaggaagatcaatcactccaagagctcg
ctctccttcctggtgccttccttgctgcagttcacgttctcagaagatgatcctattgtt
caaattgaaattgataattccagaaatattttgtatacacgatcggagaaaggagttata
caggtttatgatttgggccatgatggacaggggatgagtagagttgcttcagtttcacag
aatgccattgtctctgctgctggaaacattgctaggactattgatcgttccgtctttaag
ccaattgttcagatagctgtgattgagagttctgaatccctggactgtcagttactggct
gtcactcacgcaggtgtaaggctgtatttcagcacttgtccgtttagacagccattagct
cggccgaatacactgacactggtccacgtccggttacctcctggattttcagcatcatca
acagtggaaaagccttcaaaagtgcacaaagcactttacagtaaaggaattttactgatg
acagcctcagaaaatgaagataatgacattttatggtgtgtcaaccatgatacatttcct
tttcaaaagccaatgatggaaactcagatgacaacccgtgttgatggtcattcctgggct
ctctctgcaatagatgaattaaaagtagataaaataattacaccgttaaataaagatcat
attccaataactgattcgccagttgttgtacaacagcacatgttgcctccaaagaaattc
gttctcctctcagcacagggtagtcttatgtttcacaagcttagacctgtagatcagctg
agacatctgcttgtgagtaacgtgggaggggatggagaagagattgagagattcttcaaa
ttacatcaggaagaccaagcttgtgcaacttgccttattcttgcttgttccactgctgcc
tgtgacagagaagtgtctgcttgggcaacacgggcattctttaggtatggtggtgaggca
cagatgagatttccagctactcttcctactccaagcaacgttggtcccatccttggctct
cctatgtattctagttctcctgtccctagtgggagtccctatccaaatccatcctccttg
gggacaccatcccatggtgctcagccgcctaccatgtcaaccccaatgtgtgctgttgga
agcccagccatgcaggctgcaagcatgagtggtttgactgggccagagattgtgtactca
ggaaaacacaacggtatttgcatttacttttctcgaatcatgggaaatatttgggatgcg
agcttagttgttgaaagagtattcaagagttccaacagggagatcactgcaattgagagc
agtgtgcccgtccagctgctggagtcagtgctgcaggagctgaagggcttgcaggagttt
ctagacagaaactcccagttttcaggtggacccctgggaaatccaaatactactgccaga
gtgcagcagcggctggttgggttcatgcgtcccgagaatggaaacacccagcaaatgcaa
caggagctgcagaggaagtttcaggaggctcaactgagtgaaaagatttcacttcaggcg
atccagcagctggttagaaaatcgtaccaagctctggctctctggaaactcctttgtgaa
catcagttttctgtcattgtcggagaacttcaaaaggaatttcaagagcagctgaagatc
accacctttaaggatctggtgatcagggacaaagaggtcactggagcattaattgcttct
cttatcaactgctacatcagagacaacgccgccgtagacggcattagcttacatctgcag
gacacctgtccgcttctgtatagcacagacgatgcagtttgttctaaggcaaatgagctc
cttcagcgttcccgacaagttcagagtaagactgagagagagaggatgttacgggagtca
ctgaaggagtatcagaagatcagcaaccaagtggaccttcccagtgtctgtgctcagtat
aggcaagtgcgtttttatgagggtgtggtggaactttctcttactgctgccgagaaaaaa
gatcctcagggtcttggactccatttctataaacatggggaaccagaagaggatgtggtt
ggtcttcagactttccaagagagattaaacagttacaagtgcattacggatactctgcaa
gagctggtaaatcaaagtaaggcagctccccagtctcccagtgtacccaaaaagcctggg
cctccagtgctgtcatctgatcccaacatgctgagcaatgaagaagcaggacatcacttt
gaacaaatgcttaaattggcacagcggtccaaggatgagctcttcagcattgctctttat
aactggctaatacaagctgaccttgcagataaactgctacagattgcgtcaccatttctg
gagccacatcttgtgcgaatggccagagtggatcagaacagagtccgctatatggattta
ctctggaggtattacgagaagaacaggagcttcagcagcgccgctcgggtcctatccaag
ttggcggacatgcacagcacagaaatttcacttcagcagcgactagaatacattgctcga
gccatccttagtgcgaaaagttccactgccatctcatccatagctgcagatggtgaattc
ctgcatgagttagaagagaaaatggaagttgctagaatccaacttcagatacaagagaca
ctacaaaggcagtactcccatcattcttcagtgcaggatgcaatttctcagctggattct
gagctcatggacattactaagctctatggggaatttgctgacccgtttaaacttgcagag
tgtaaacttgcagtcattcattgcgctggttactcagatcccatattggtgcacacactc
tggcaagatatcatagagaaagaattgaacgacagcgtagcattgagctcgtcagatcga
atgcatgctctcagcctcaagcttgtcctcctcggcaaaatctatgctgggacgcctcgg
tttttccctctggattttatcgtgcagttcttggagcagcaagtttgtaccttaaactgg
gatgtggggtttgtgatacagaccatgaatgaaatcggcgtgcctttacctaggctgcta
gaagtttatgatcagctcttcaaatcacgggatccattctggaacagagtgaaaagccca
ctgcaccttctggattgtatccatgtactgttgacaagatatgttgagaatcctagccta
gttttaaattgtgagaggagaaggtttacaaatctctgcctggatgccgtctgtggatat
ctggtggaacttcagtcaatgagttcttcagtagcagtacaagccatcactgggaatttt
aaatcgctccaagcaaagctggaacggctccattga

DBGET integrated database retrieval system