KEGG   Mus musculus (mouse): 170822Help
Entry
170822            CDS       T01002                                 

Gene name
Usp33, 9830169D19Rik, AA409780, Vdu1
Definition
ubiquitin specific peptidase 33 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     170822 (Usp33)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   170822 (Usp33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 H3; 3
AA seq 897 aa AA seqDB search
MTTFRNHCPHLDSVGEITKEDLIQKSLGACQDCKVRGPNLWACLENRCSYVGCGESQVDH
STIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTPPSLPHVRQPQQTQENSVQDFK
IPSNPALKTPMVAVSEDLDIEVEEEDELKARGLTGLKNIGNTCYMNAALQALSNCPPLTQ
FFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPANLFQGIKTVNPTFRGYSQQD
AQEFLRCLMDLLHEELKEQVMEMEEEPQTLTSEETVEEEKSQSDVDFQSCESCSSSEKAE
NESGSKGFPEDSNETTMLIQDEDDLEMAKDWQKEKVCNKINKANADVELDKDRDTVCETV
DLNSQETVKVQIHGRASESITDVHLNDLATSQILPSNESVSPRLSASPPKLGSLWPGLSP
PHKKAQSTSAKRKKQHKKYRSVISDIFDGTVISSVQCLTCDRVSITLETFQDLSLPIPGK
EDLAKLHSSSHPTIVKAGSCGEAYAPQGWIAFFMEYVKSWFWGPVVTLQDCLAAFFARDE
LKGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKISTHVSFPLEGLD
LQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSEST
VQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISN
NDFLCIHGGIPPRKASYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIELEKIE
KRRKTELEIFIRLNRAFQEEDSPATFYCISMQWFREWESFVKDPPGPIDNTKIAVTKCGS
VMLKQGADSGQISEETWNFLQSIYGGGPEVILRPPVVHVDPDVLQAEEKIEVETRSL
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttttcgaaatcattgtccacatttggattcagttggtgaaataacgaaagag
gacttgatacagaaatctctcggcgcttgtcaggactgtaaagtcagaggaccaaacctg
tgggcgtgcctggagaataggtgctcctatgttggctgcggggagtcgcaagtggaccac
agcaccatacactcgcaggagacaaagcattatctaactgtgaacctcaccactcttcga
gtatggtgttatgcttgcagcaaagaagtatttttggatagaaaattaggaactcctcct
tcattacctcatgtaagacagcctcaacaaacacaagaaaacagtgtccaggattttaaa
attcccagtaatccagcattgaaaacccccatggttgctgtgtctgaagatctggatata
gaagtggaagaggaagacgagctgaaggctagaggcctgacaggtttgaaaaacattgga
aatacttgttatatgaacgcggcgctgcaggctctttctaactgcccacctttgacacag
ttctttcttgattgtggaggactggctagaacagataagaaaccagcaatttgtaaaagt
tatctcaaactaatgaccgagttgtggcacaagagcaggccaggatctgttgtgccggct
aatctgttccaaggaattaaaactgtaaatccaacttttcgaggttattctcagcaggat
gcccaggaattccttcgctgtctaatggacctgcttcatgaggagctgaaggagcaggtc
atggaaatggaggaagagcctcaaacactaacttctgaggagacggtggaggaagagaag
agccagtcagatgtggattttcagtcgtgcgagtcttgtagcagcagcgagaaagcagaa
aatgagagtggctccaaaggctttcctgaggacagcaatgagaccaccatgctcatccag
gacgaggatgacctggagatggccaaagactggcagaaagagaaggtgtgcaataagatc
aacaaggcaaatgccgatgtagaactggacaaagacagggacacagtgtgtgaaacagtt
gacctaaacagccaggagaccgtcaaagtgcagatacacggcagagcctcagaatctatc
actgatgtccatctgaatgacctagctacgtcacagatccttccttcaaatgaaagtgtt
agtccacggttatcagcaagccctcctaagctaggcagtctgtggccaggactgtcgcct
ccacacaagaaagctcagtctacatctgcaaagaggaaaaagcagcataagaaatacaga
agtgtcatctccgacatattcgatggaacagtcattagctcggtacagtgtctgacgtgc
gatagggtgtctataaccctcgagacctttcaggatctgtccttgccgattcctggcaag
gaggacctggctaagctgcactcctccagtcacccaactatagtcaaagcagggtcatgt
ggtgaagcgtacgccccgcaggggtggatagctttcttcatggagtatgtgaagagctgg
ttttggggtccagtagttaccttgcaagattgtcttgctgccttcttcgccagagatgaa
cttaaaggtgacaacatgtacagttgtgaaaaatgcaaaaagttgaggaatggagtaaag
ttttgtaaagtacagaagtttcctgagattttgtgtatccaccttaaaagatttcgacat
gaactgatgttttccaccaaaattagcacccatgtttccttccccctggaaggcctcgat
cttcagccatttcttgcaaaggacagcccagctcagattgtgacatatgatctcctgtca
gtcatctgtcaccatgggactgcaagtagtgggcactacattgcctactgccgaaacaat
ttaaataacctgtggtatgagtttgatgaccagagcgtcactgaagtttcagagtccact
gtacagaatgccgaggcctacgtccttttctacaggaagagcagtgaagaggcacaaaag
gagaggcggaggatatcaaatttgttgaacatcatggaacctagcctccttcagttctac
atatctcgacagtggttgaataaatttaagacctttgctgaacctggccctatttcaaat
aatgattttctctgtatccatggaggtattcctccacgaaaagcgagttatattgaagac
ttagttttgatgctgcctcagaacatttgggataacctctatagcaggtatggaggaggg
cctgctgtcaaccatctctacatctgccacacctgccaaattgagttagagaagattgaa
aaacgaagaaaaaccgaattggaaatttttattcggctcaacagagcatttcaagaggag
gactccccagctactttttactgtatcagcatgcagtggtttagagaatgggagagtttt
gtaaaggatcccccaggtccaatcgacaacactaaaattgcggttactaaatgtggcagt
gtgatgctcaagcaaggagcagactctggtcaaatttcagaagaaacatggaatttcctg
cagtctatatatggtggggggcctgaagttatcctccgacctccagttgttcatgttgac
cctgatgtactccaagcagaggaaaagattgaagtagaaactcgctctttgtag

DBGET integrated database retrieval system