KEGG   Mus musculus (mouse): 17105Help
Entry
17105             CDS       T01002                                 

Gene name
Lyz2, AI326280, Lys, Lysm, Lyzs, Lzm, Lzm-s1, Lzp
Definition
lysozyme 2 (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    17105 (Lyz2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     17105 (Lyz2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   17105 (Lyz2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 D2; 10 65.34 cM
AA seq 148 aa AA seqDB search
MKTLLTLGLLLLSVTAQAKVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRA
TNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRAHCQNRDLSQYIRNCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaagactctcctgactctgggactcctcctgctttctgtcactgctcaggccaaggtc
tatgaacgttgtgagtttgccagaactctgaaaaggaatggaatggctggctactatgga
gtcagcctggccgactgggtgtgtttagctcagcacgagagcaattataacacacgagct
acaaactacaaccgtggagaccaaagcactgactatgggatatttcagatcaatagccga
tactggtgtaatgatggcaaaaccccaagagctgtgaatgcctgtgggatcaattgcagt
gctctgctgcaggatgacatcactgcagccatacaatgtgcaaagagggtggtgagagat
ccccaaggcattcgagcatgggtggcatggcgagcacactgtcaaaaccgagatctgtcc
cagtatattcggaactgcggagtctga

DBGET integrated database retrieval system