KEGG   Mus musculus (mouse): 17110Help
Entry
17110             CDS       T01002                                 

Gene name
Lyz1, Lyz, Lzp-s
Definition
lysozyme 1 (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    17110 (Lyz1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     17110 (Lyz1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   17110 (Lyz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 D2; 10
AA seq 148 aa AA seqDB search
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA
TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRTQCQNRDLSQYIRNCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcctgactctgggactcctcctgctttctgtcactgcccaggccaaggtc
tacaatcgttgtgagttggccagaattctgaaaaggaatggaatggatggctaccgtggt
gtcaagctggctgactgggtgtgtttagctcagcatgagagcaattataacacacgagct
acaaactacaaccgtggagaccgaagcaccgactatgggatatttcagatcaatagccga
tactggtgtaatgatggcaaaaccccaagatctaagaatgcctgtgggatcaattgcagt
gctctgctgcaggatgacatcactgcagccatacaatgtgcaaagagggtggtgagagat
ccccaaggcattcgagcatgggtggcatggcgaacacaatgtcaaaaccgagatctgtcc
cagtatattcggaactgcggagtctga

DBGET integrated database retrieval system