KEGG   Mus musculus (mouse): 17118Help
Entry
17118             CDS       T01002                                 

Gene name
Marcks, Macs, PKCSL
Definition
(RefSeq) myristoylated alanine rich protein kinase C substrate
  KO
K12561  
myristoylated alanine-rich C-kinase substrate
Organism
mmu  Mus musculus (mouse)
Pathway
Fc gamma R-mediated phagocytosis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    17118 (Marcks)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    17118 (Marcks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 B1; 10 19.49 cM
AA seq 309 aa AA seqDB search
MGAQFSKTAAKGEATAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAEPGAKEELQA
NGSAPAADKEEPASGSAATPAAAEKDEAAAATEPGAGAADKEAAEAEPAEPSSPAAEAEG
ASASSTSSPKAEDGAAPSPSSETPKKKKKRFSFKKSFKLSGFSFKKSKKESGEGAEAEGA
TAEGAKDEAAAAAGGEGAAAPGEQAGGAGAEGAAGGEPREAEAAEPEQPEQPEQPAAEEP
QAEEQSEAAGEKAEEPAPGATAGDASSAAGPEQEAPAATDEAAASAAPAASPEPQPECSP
EAPPAPTAE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcccagttctccaagaccgcagcgaagggagaagccaccgccgagaggcccggg
gaggcggctgtggcctcgtcgccttccaaagcaaatgggcaggagaatggccacgtaaaa
gtgaacggggacgcgtctcccgccgccgccgagccgggcgccaaggaggagctgcaagcc
aacggcagcgccccggccgccgacaaggaggagcccgcgagcggcagtgccgcgaccccc
gccgcggccgaaaaggatgaggctgccgcggccaccgagccgggcgccggcgcggccgac
aaggaggctgcggaggccgagcccgccgagcccagctccccggccgccgaggccgagggc
gcgtccgcctcctccacgtcgtcgcccaaggcggaggacggggccgcgccgtcgcccagc
agcgagaccccgaaaaaaaaaaagaagcgcttttccttcaagaagtccttcaagctgagc
ggcttctccttcaagaagagcaagaaggagtcgggcgagggcgctgaagcagagggagcg
accgcggaaggcgccaaggacgaggctgcagccgcagcgggcggcgagggggccgcggcc
cccggggagcaggcaggcggggcgggcgccgagggcgcggcgggcggagagccccgggag
gccgaggcggcggagcccgagcagccggagcagccggagcagcccgcggcggaggagccg
caggcggaggagcagtcggaggcggcgggggagaaggcggaggagcccgcgcccggcgcc
accgcgggcgatgcgtcctccgccgcagggcctgagcaggaggcgcccgctgccaccgac
gaggccgcggcgtccgcagcccccgccgcgtcgccggagccgcagcccgagtgcagtccg
gaggcgccccccgcgccaacggccgagtaa

DBGET integrated database retrieval system