KEGG   Mus musculus (mouse): 17127Help
Entry
17127             CDS       T01002                                 

Gene name
Smad3, AU022421, Madh3
Definition
SMAD family member 3
Orthology
K04500  
mothers against decapentaplegic homolog 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Cell cycle
Endocytosis
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:mmu04310]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:mmu04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:mmu04390]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mmu04068]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mmu04144]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mmu04110]
Cellular Processes; Cell communication; Adherens junction [PATH:mmu04520]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Colorectal cancer [PATH:mmu05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:mmu05212]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mmu05220]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:mmu05321]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mmu05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 D; 9
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggttggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagcttggtgaag
aagctcaagaagacggggcagttggacgagctggagaaggccatcaccacgcagaacgtg
aacaccaagtgcattaccatccccaggtcactggatggtcggctgcaggtgtcccatcgg
aaggggctccctcacgttatctactgccgcctgtggcgatggcccgacctgcacagccac
catgaattacgggccatggagctctgtgagtttgccttcaacatgaagaaggatgaagtg
tgtgtaaatccttaccactatcagagagtagagacgccagttctacctccagtgttggtg
ccacgccacaccgagatcccggccgagttccccccactggatgactacagccattccatt
cccgagaacactaacttccctgctggcattgagccccagagcaatattccagaaacccca
cctcctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctctccccgaatccgatgtccccagcacacaataacttggac
ctacagccagtcacctactgtgagccggccttctggtgctccatctcctactacgagctg
aaccagcgagttggggagacattccacgcctcacagccatccatgacagtagatggcttc
actgacccctccaactcggagcgcttctgcctgggcctactgtccaatgtcaaccggaat
gcagccgtggaacttacaaggcgacacattgggagaggtgtgcggctctactacatcgga
ggggaggtctttgcggagtgcctcagtgacagtgctattttcgtccagtctcccaactgc
aaccagcgctatggctggcacccggccactgtctgcaagatcccaccaggctgcaacctg
aagatcttcaacaaccaggaatttgctgccctcctagctcagtctgtcaaccagggcttt
gaggctgtctaccagctgacgcgcatgtgcaccatccgtatgagcttcgtcaaaggctgg
ggagcagagtacaggagacagacagtgaccagcaccccctgctggattgagctacacctg
aatggacccttgcagtggcttgacaaggtcctcacccagatgggttccccgagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system