KEGG   Mus musculus (mouse): 17127Help
Entry
17127             CDS       T01002                                 

Gene name
Smad3, AU022421, Madh3
Definition
SMAD family member 3
Orthology
K04500  
mothers against decapentaplegic homolog 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Cell cycle
Endocytosis
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    17127 (Smad3)
   04350 TGF-beta signaling pathway
    17127 (Smad3)
   04390 Hippo signaling pathway
    17127 (Smad3)
   04068 FoxO signaling pathway
    17127 (Smad3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    17127 (Smad3)
  Cell growth and death
   04110 Cell cycle
    17127 (Smad3)
  Cellular commiunity
   04520 Adherens junction
    17127 (Smad3)
   04550 Signaling pathways regulating pluripotency of stem cells
    17127 (Smad3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    17127 (Smad3)
   05210 Colorectal cancer
    17127 (Smad3)
   05212 Pancreatic cancer
    17127 (Smad3)
   05220 Chronic myeloid leukemia
    17127 (Smad3)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    17127 (Smad3)
  Infectious diseases
   05166 HTLV-I infection
    17127 (Smad3)
   05142 Chagas disease (American trypanosomiasis)
    17127 (Smad3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 D; 9
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggttggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagcttggtgaag
aagctcaagaagacggggcagttggacgagctggagaaggccatcaccacgcagaacgtg
aacaccaagtgcattaccatccccaggtcactggatggtcggctgcaggtgtcccatcgg
aaggggctccctcacgttatctactgccgcctgtggcgatggcccgacctgcacagccac
catgaattacgggccatggagctctgtgagtttgccttcaacatgaagaaggatgaagtg
tgtgtaaatccttaccactatcagagagtagagacgccagttctacctccagtgttggtg
ccacgccacaccgagatcccggccgagttccccccactggatgactacagccattccatt
cccgagaacactaacttccctgctggcattgagccccagagcaatattccagaaacccca
cctcctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctctccccgaatccgatgtccccagcacacaataacttggac
ctacagccagtcacctactgtgagccggccttctggtgctccatctcctactacgagctg
aaccagcgagttggggagacattccacgcctcacagccatccatgacagtagatggcttc
actgacccctccaactcggagcgcttctgcctgggcctactgtccaatgtcaaccggaat
gcagccgtggaacttacaaggcgacacattgggagaggtgtgcggctctactacatcgga
ggggaggtctttgcggagtgcctcagtgacagtgctattttcgtccagtctcccaactgc
aaccagcgctatggctggcacccggccactgtctgcaagatcccaccaggctgcaacctg
aagatcttcaacaaccaggaatttgctgccctcctagctcagtctgtcaaccagggcttt
gaggctgtctaccagctgacgcgcatgtgcaccatccgtatgagcttcgtcaaaggctgg
ggagcagagtacaggagacagacagtgaccagcaccccctgctggattgagctacacctg
aatggacccttgcagtggcttgacaaggtcctcacccagatgggttccccgagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system