KEGG   Mus musculus (mouse): 171382Help
Entry
171382            CDS       T01002                                 

Gene name
Trpm8, CMR1, LTRPC6, LTrpC-6, TRPP8, Trp-p8
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 8
  KO
K04983  
transient receptor potential cation channel subfamily M member 8
Organism
mmu  Mus musculus (mouse)
Pathway
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    171382 (Trpm8)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   171382 (Trpm8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 D
AA seq 1104 aa AA seqDB search
MSFEGARLSMRSRRNGTMGSTRTLYSSVSRSTDVSYSDSDLVNFIQANFKKRECVFFTRD
SKAMENICKCGYAQSQHIEGTQINQNEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYLRL
SCDTDSETLYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRNSEENIVAIGIAAWGMVSNRDTLIRSCDDEGHFSAQY
IMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTSQDSNYGGKIP
IVCFAQGGGRETLKAINTSVKSKIPCVVVEGSGQIADVIASLVEVEDVLTSSMVKEKLVR
FLPRTVSRLPEEEIESWIKWLKEILESSHLLTVIKMEEAGDEIVSNAISYALYKAFSTNE
QDKDNWNGQLKLLLEWNQLDLASDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLQKFLTNEVLTELFSTHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRSFWKEDR
SSREDLDVELHDASLTTRHPLQALFIWAILQNKKELSKVIWEQTKGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGLVSFRKKPIDKH
KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHTPELILYALVFVLFC
DEVRQWYMNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDSTTYDFSHCTFSGNESKPLCVELDEHNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGIVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAY
FYMVVKKCFKCCCKEKNMESNACCFRNEDNETLAWEGVMKENYLVKINTKANDNSEEMRH
RFRQLDSKLNDLKSLLKEIANNIK
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgagggagccaggctcagcatgaggagccgcagaaatggtactatgggcagc
acccggaccctgtactccagtgtatctcggagcacagacgtgtcctacagtgacagtgat
ttggtgaattttattcaggcaaattttaaaaaacgagaatgtgtcttctttaccagagac
tccaaggccatggagaacatatgcaagtgtggttatgcccagagccagcacatcgaaggc
acccagatcaaccaaaatgagaagtggaactacaaaaaacataccaaggagtttccaaca
gacgccttcggggacattcagtttgagactctggggaagaaaggcaagtacttacgcttg
tcctgtgacaccgactctgaaactctctacgaactgctgacccagcactggcacctcaaa
acacccaacctggtcatttcagtgacgggtggagccaaaaactttgctttgaagccacgc
atgcgcaagatcttcagcaggctgatttacatcgcacagtctaaaggtgcgtggattctc
actggaggcactcactacggcctgatgaagtacataggcgaggtggtgagagacaacacc
atcagcaggaactcagaagagaacatcgtggccattggcatcgcagcatggggcatggtc
tccaacagggacaccctcatcaggagctgtgatgatgagggacatttttcagctcaatac
atcatggatgactttaccagagaccctctatacatcctggacaacaaccatacccacctg
ctgcttgtggacaacggttgtcatggacaccccacagtggaagccaagctccggaatcag
ctggaaaagtacatctctgagcgcaccagtcaagattccaactatggtggtaagatcccc
atcgtgtgttttgcccaaggaggtggaagagagactctaaaagccatcaacacctctgtc
aaaagcaagatcccttgtgtggtggtggaaggctcggggcagattgctgatgtgatcgcc
agcctggtggaggtggaggatgttttaacctcttccatggtcaaagagaagctggtacgc
tttttaccacgcactgtgtcccggctgcctgaagaggaaattgagagctggatcaaatgg
ctcaaagaaattcttgagagttctcacctactcacagtaattaagatggaagaggctgga
gatgagattgtgagcaacgccatttcctatgcgctgtacaaagccttcagcactaatgag
caagacaaggacaactggaatggacagctgaagcttctgctggagtggaaccagttggac
cttgccagtgatgagatcttcaccaatgatcgccgctgggagtctgccgaccttcaggag
gtcatgttcacggctctcataaaggacagacccaagtttgtccgcctctttctggagaat
ggcctgaatctgcagaagtttctcaccaatgaagtcctcacagagctcttctccacccac
ttcagcaccctagtgtaccggaatctgcagatcgccaagaactcctacaatgacgcactc
ctcacctttgtctggaagttggtggcaaacttccgtcgaagcttctggaaagaggacaga
agcagcagggaggacttggatgtggaactccatgatgcatctctcaccacccggcacccg
ctgcaagctctcttcatctgggccattcttcagaacaagaaggaactctccaaggtcatt
tgggagcagaccaaaggctgtactctggcagccttgggggccagcaagcttctgaagacc
ctggccaaagttaagaatgatatcaacgctgctggggaatcggaggaactggccaatgaa
tatgagacccgagcagtggagttgttcaccgagtgttacagcaatgatgaagacttggca
gaacagctactggtctactcctgcgaagcctggggtgggagcaactgtctggagctggca
gtggaggctacagatcagcatttcatcgctcagcctggggtccagaatttcctttctaag
caatggtatggagagatttcccgagacacgaagaactggaagattatcctgtgtctattc
atcatccccttagtgggctgtggcctcgtatcatttaggaagaaacccattgacaagcac
aagaagctgctgtggtactatgtggccttcttcacgtcgcccttcgtggtcttctcctgg
aacgtggtcttctacatcgccttcctcctgctgtttgcctatgtgctgctcatggacttc
cactcagtgccacacacccccgagctgatcctctacgccctggtcttcgtcctcttctgt
gatgaagtgaggcagtggtacatgaacggagtgaattatttcaccgacctatggaacgtt
atggacaccctgggactcttctacttcatagcgggtattgtattccggctccactcttct
aataaaagctcgttgtactctgggcgcgtcattttctgtctggattacattatattcacg
ctaaggctcatccacattttcaccgtcagcaggaacttgggacccaagattataatgctg
cagcggatgctgatcgacgttttcttcttcctgttcctctttgctgtgtggatggtggcc
tttggcgtggccagacaggggatcctaaggcaaaatgaacagcgctggagatggatcttc
cgctctgtcatctatgagccctacctggccatgtttggccaggttcccagtgacgtggat
agtaccacatatgacttctcccactgtaccttctcgggaaatgagtccaagccactgtgt
gtggagctggatgagcacaacctgccccgcttccctgagtggatcaccattccgctggtg
tgcatctacatgctctccaccaatatccttctggtcaacctcctggtcgccatgtttggc
tacacggtaggcattgtacaggagaacaacgaccaggtctggaaattccagcggtacttc
ctggtgcaggagtactgcaaccgcctaaacatccccttccccttcgttgtcttcgcttat
ttctacatggtggtgaagaagtgtttcaaatgctgctgtaaagagaagaatatggagtct
aatgcctgctgtttcagaaatgaggacaatgagactttggcgtgggagggtgtcatgaag
gagaattaccttgtcaagatcaacacgaaagccaacgacaactcagaggagatgaggcat
cggtttagacaactggactcaaagcttaacgacctcaaaagtcttctgaaagagattgct
aataacatcaagtaa

DBGET integrated database retrieval system