KEGG   Mus musculus (mouse): 171469Help
Entry
171469            CDS       T01002                                 

Gene name
Gpr37l1, AW047233, CAG-18, D0Kist8
Definition
(RefSeq) G protein-coupled receptor 37-like 1
  KO
K04244  
endothelin type b receptor-like protein 2
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin B like
    171469 (Gpr37l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 E4
AA seq 481 aa AA seqDB search
MRWLWPLAVSLVVVLTVGLSGVSGAATSSLGGHRAKVQEQQSRPRRGTKDEGPKEVQHYV
PEEWAEYPKPIHPAGLQPTKTLEATSPNPDKDGATPGNGQELRVNLTGTPSQRLQIQNPL
YPVTESSYSAYAIMLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVL
FFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVR
PIERCQSILAKLAVIWVGSMMLAVPELLLWQLAQEPAPTAGTVDSCIMKPSADLPESVYS
LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKPECRAGRHEQCESQLNST
VVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCIC
RPLGQAFLDCCCCCCCEECGGASDSSATVSADSKLKAEVSSSIYFHKPRESPPLLPLGTP
C
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggctgtggcccctggctgtgtctcttgttgtagtgttgactgtggggctgagt
ggggtctctggggctgccacctcatctttaggtgggcatagagccaaggtccaggagcag
cagagtcgaccccgaagaggcaccaaggacgaggggcccaaggaggtacagcactatgta
cccgaggagtgggctgaatatcccaagcccatccatcctgctggcctgcagcccaccaag
actttggaggccactagccccaacccagacaaggatggggccaccccaggtaatggacaa
gagctgagggtcaacctgaccgggacgccaagtcagaggctgcagattcagaaccccctg
tatccggtgaccgagagctcctacagcgcctacgccatcatgctcctggctctggtggtg
tttgctgtgggtatcgttggcaatctgtctgtcatgtgcattgtgtggcacagctactac
ttgaagagtgcctggaactctatccttgccagcctggctctctgggatttcctggtcctc
ttcttctgcctcccaattgtcatcttcaatgagattaccaagcaaaggctactcggggat
gtttcttgccgggcagtgcccttcatggaggtctcctccctgggagtcacaaccttcagt
ctctgtgccctgggcatagaccgattccatgtggccaccagcaccctgccaaaggtgagg
cccattgagcgatgtcaatcaattctggctaaactagctgtcatctgggtgggctccatg
atgctggccgtgcccgaactcctgctatggcagctggcccaggagccggctcccaccgca
ggaactgtggactcgtgtatcatgaaaccttcagctgacctgcccgaatctgtctattcg
ctggtgatgacctaccagaatgcccgcatgtggtggtattttggttgctacttctgtctg
cccatcctcttcaccgtcacctgtcagctggtgacgtggcgggtgcggggcccaccaggc
aggaagcctgagtgtagagcgggcaggcatgagcagtgtgagagccagctcaacagcacc
gtggtcggcctgactgtggtctatgccttctgtacactccctgagaacgtctgcaatatc
gtggtggcttacctctctaccgagctcacgcggcagaccctggacctcctgggcctcatc
aaccagttctccaccttctttaagggcgccatcacccctgtgctcctcctgtgcatctgc
aggccactgggccaggcctttctggattgctgctgctgctgctgctgcgaggagtgcggc
ggggcctcagactcctcagccacagtcagcgcggacagcaagctgaaggcggaagtgtcc
tcttctatctacttccacaagcccagggagtcgcccccactcctgcccctgggcacccct
tgctga

DBGET integrated database retrieval system