KEGG   Mus musculus (mouse): 171531Help
Entry
171531            CDS       T01002                                 

Gene name
Mlph, 2210418F23Rik, 5031433I09Rik, AW228792, D1Wsu84e, Slac-2a, l(1)-3Rk, l1Rk3, ln
Definition
(RefSeq) melanophilin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 D; 1 45.73 cM
AA seq 590 aa AA seqDB search
MGKRLDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQKESSKRELLSDTAHLN
ETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVVKIGSLEW
YYQHVRARFKRFGSAKVIRSLCGRLQGGGGSEPSLEEGNGDSEQTDEDGDLDTEARDQPL
NSKKKKRLLSFRDVDFEEDSDHLVQPCSQTLGLSSVPESAHSLQSLSGEPYSEDTTSLEP
EGLEETGARALGCHPSPEVQPCSPLPSGEDAHAELDSPAASCKSAFGTTAMPGTDDVRGK
HLPSQYLADVDTSDEDSIQGPRAASQHSKRRARTVPETQILELNKRMSAVEHLLVHLENT
VLPPSAQEPTVETHPSADTEEETLRRRLEELTSNISGSSTSSEDETKPDGTFLGGSPKVC
TDTGHMETQERNPRSPGNPARPTKSTDEELSEMEDRVAMTASEVQQAESEISDIQSRIAA
LRAAGLTVKPSGKPRRKSGIPIFLPRVTEKLDRIPKTPPADPDDQAKMPKATTAVPSLLR
RKYSPSSQGVDSGSFDRKSVYRGSLTQRNPNGRRGTARHIFAKPVMAQQP
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaggttggacctttccacgctcacagacgaggaggctgagcacgtgtgggca
gtggttcagcgggactttgacctcaggaggcgagaggaagaaagactccaggggctgaag
ggcaaaatacaaaaggagagctccaagagggagctgctgtcggacacagcccatctgaat
gagactcactgtgcccgctgcctgcagccctaccggctgctcctgaacagcagacgacag
tgcctagagtgcagcctcttcgtctgcaaaagctgcagccacgcccacccagaagagcag
ggctggctctgcgacccctgccacctggccagggtcgtgaagatcggttctctggagtgg
tactaccagcacgtgagggctcgcttcaagcgtttcgggagtgccaaagtgatccggtct
ctctgtgggcggctgcagggtggaggtggatctgagccaagcttggaagaaggaaatgga
gacagtgagcagactgatgaggatggagacctggacacagaggccagagaccagcccctc
aacagcaaaaagaaaaagcgcctgctctccttccgagatgtggactttgaggaagactca
gaccacttggtgcagccttgcagccaaaccttgggcctgtcctcagtccctgagtctgca
cacagcctgcagtccctctcaggtgagccctactctgaggacaccacctctctggagccc
gagggcctagaggagactggtgcaagggctttgggatgtcatcccagtcctgaagtgcag
ccatgtagccctttaccctctggggaggatgctcacgctgaactggactcgcctgcagca
tcctgcaagagtgcctttgggaccacagctatgcctggaacagacgatgtcaggggcaaa
catctgccctcacagtacctggctgatgtagacacctctgatgaagacagtatccagggt
cccagggcagcctcccagcatagcaagaggagggcccggactgtgcctgagactcagatc
ttggagttgaacaagcgaatgtcagctgtggagcacctgctagtccacctggagaatacg
gttctgccaccctcagcccaggaaccaactgtggagacacaccccagtgctgacacagag
gaggagacactcaggaggaggctggaggagctgaccagcaacatcagtggttccagcacc
tcatcagaagatgagaccaagccagatggcaccttccttggagggtccccaaaggtgtgc
acagacacagggcacatggagacacaggaaaggaaccctcggagccctgggaaccctgct
cggcctacaaaaagcacagatgaggagctctctgagatggaggatagagtggccatgaca
gcctctgaagttcagcaggctgagagtgagatctcagacatccagtccaggatcgcagct
ctgagagccgcaggactcacagtgaagccctcgggaaaacctcggagaaagtcaggcatc
ccgatctttcttccccgcgttactgagaaacttgacaggatcccaaagactccacctgca
gaccctgatgaccaagccaagatgcccaaggcaacaacagctgtgccctctctcctgagg
aggaagtattctcccagcagccaaggcgtagacagtggttcttttgatcggaaatcagtg
taccgtggctcgctgacacaaaggaaccctaacgggaggagagggacagccagacacatc
ttcgcgaaacccgtgatggcccagcagccctaa

DBGET integrated database retrieval system