KEGG   Mus musculus (mouse): 17165Help
Entry
17165             CDS       T01002                                 

Gene name
Mapkapk5, MK5, PRAK
Definition
(RefSeq) MAP kinase-activated protein kinase 5 (EC:2.7.11.1)
  KO
K04442  
mitogen-activated protein kinase-activated protein kinase 5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    17165 (Mapkapk5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17165 (Mapkapk5)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [OT]
   17165 (Mapkapk5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F
AA seq 473 aa AA seqDB search
MSEDSDMEKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKAR
NEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHF
TEKQASQVTKQIALALQHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKVDQGDL
MTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPP
FYSKHHSRTIPKDMRKKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPIL
RKRKLLGTKPKDGIYIHDHENGTEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ
EAWKYNRECKLLRDALQSFSWNGRGFTDKVDRLKLAEVVKQVIEEQTLPHEPQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggacagcgacatggagaaagccatcaaggagacctccattttagaagaatat
agtatcaattggactcagaaactgggagccggaattagtggtccagttagagtctgtgtg
aagaaatccactcaagaacggtttgcactgaaaattcttcttgatcgtccaaaagctaga
aatgaggtgcgcctgcacatgatgtgtgccacacaccccaacatagttcagattattgaa
gtgtttgctaacagtgtacagttccctcatgagtccagccccagggctcgactcttaatt
gtaatggagatgatggaagggggagagctatttcacagaatcagccagcaccggcacttt
acagagaagcaagccagccaagtaacaaagcagatagccctggctctacagcactgtcac
ttgctaaacattgcgcacagagacctcaagcctgaaaatctgcttttcaaggataactct
ctggacgcccctgtgaaattatgtgactttgggtttgctaaagttgaccaaggtgatttg
atgacaccccagtttaccccttactatgtagcacctcaggtactggaagcgcagagacgg
caccagaaggagaagtctggcatcatacctacctcgccaacaccctacacttacaacaag
agctgtgacttgtggtccctaggggtgataatttatgtgatgctgtgcggatatcctcct
ttttactccaaacaccatagtcggactatcccaaaggatatgcggaaaaagatcatgaca
ggaagtttcgagttcccagaagaagagtggagccagatctcagagatggctaaagatgtt
gtgaggaagcttctgaaggtcaaaccagaggaaagactcacaatcgagggagtgttggac
catccctggctcaactcgacagaggccctggataatgtgctaccctctgcccagctgatg
atggataaggcggtggttgcggggatccagcaggcgcacgccgagcagctggcaaacatg
aggatccaggacctcaaggtcagcctcaaacccctgcactctgtcaacaaccccattctc
aggaagaggaagctgctgggcaccaagccaaaggacggtatttatatacacgaccatgag
aatggaactgaggactcaaatgttgccttggaaaagcttcgagatgtcattgcccagtgt
atcctcccccaggctggtaaaggagagaatgaagatgagaagctgaatgaggtaatgcag
gaggcctggaagtacaaccgcgaatgcaagctcctgagggatgctctgcagagttttagc
tggaatggccgtggattcacagataaagttgaccgattgaagctggcagaggtggtaaag
caggtgatcgaagagcagacccttccccacgagccccagtag

DBGET integrated database retrieval system