KEGG   Mus musculus (mouse): 17210Help
Entry
17210             CDS       T01002                                 

Gene name
Mcl1, AW556805, Mcl-1
Definition
(RefSeq) myeloid cell leukemia sequence 1
  KO
K02539  
myeloid leukemia cell differntiation protein MCL-1
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    17210 (Mcl1)
   04151 PI3K-Akt signaling pathway
    17210 (Mcl1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    17210 (Mcl1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    17210 (Mcl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 F2.1; 3 40.74 cM
AA seq 331 aa AA seqDB search
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP
PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA
VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcctgcggagaaacgcggtcatcggcttgaacctgtactgcggcggcgccagc
ctcggcgcgggcggcggttctccggcaggggcgcgcctggtggccgaggaggccaaggcg
cggcgcgaggggggaggggaggccgccctgctgcccggcgcgcgggtggtcgcccggccg
ccgcccgtgggcgccgaggaccccgacgtcaccgcgtcggccgaaaggcggctgcataag
tcgcccggcctcctcgccgtgccgcccgaggagatggccgcgtcggccgccgccgccatc
gtgtctccggaggaggaactggacggctgcgagccggaggccatcggcaagcgcccggcc
gtgctgcccctcctggagcgcgtgagcgaggcggccaagagctccggggccgacggctct
ctgccctccacgccgccgccgcccgaggaggaagaggacgacctataccgccagtcgctg
gagatcatctcgcgctacttgcgggagcaggcgaccggctccaaggactcgaagcctctg
ggcgaggcgggcgcggcgggccggagagcgctggagaccctgcggcgcgtgggcgacggc
gtgcagcgcaaccacgagacggccttccagggcatgctccggaaactggacattaaaaac
gaaggcgatgttaaatctttttctcgagtaatggtccatgttttcaaagatggcgtaaca
aactggggcaggattgtgactcttatttctttcggtgcctttgtggccaaacacttaaag
agcgtaaaccaagaaagcttcatcgaaccattagcagaaactatcacagatgttcttgta
aggacgaaacgggactggcttgtcaaacaaagaggctgggatgggtttgtggagttcttc
cacgtacaggacctagaaggcggcatcagaaatgtgctgctggcttttgcgggtgttgct
ggagtaggggctggtctggcatatctaataagatag

DBGET integrated database retrieval system