KEGG   Mus musculus (mouse): 17217Help
Entry
17217             CDS       T01002                                 

Gene name
Mcm4, 19G, AI325074, AU045576, Cdc21, Mcmd4, mKIAA4003, mcdc21
Definition
(RefSeq) minichromosome maintenance complex component 4
  KO
K02212  DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu04110  Cell cycle
Module
mmu_M00285  MCM complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    17217 (Mcm4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    17217 (Mcm4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     17217 (Mcm4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    17217 (Mcm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_N Mg_chelatase AAA_5 AAA_3 AAA Elf1
Motif
Other DBs
NCBI-GeneID: 17217
NCBI-ProteinID: NP_032591
MGI: 103199
Ensembl: ENSMUSG00000022673
UniProt: P49717 Q542F4 Q3UA65
Position
16 A2; 16 10.09 cM
AA seq 862 aa AA seqDB search
MSSPASTPSRRSSRRGRVTPTQSLRSEESRSSPNRRRRGEDSSTGELLPMPTSPGADLQS
PPAQNALFSSPPQMHSLAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSA
RKGLQVDLQSDGAAAEDIVPSEQSLGQKLVIWGTDVNVATCKENFQRFLQCFTDPLAKEE
ENVGIDITQPLYMQQLGEINITGEPFLNVNCEHIKSFSKNLYRQLISYPQEVIPTFDMAV
NEIFFDRYPDSILEHQIQVRPFNALKTKSMRNLNPEDIDQLITISGMVIRTSQLIPEMQE
AFFQCQVCAHTTRVEIDRGRIAEPCSCVHCHTTHSMALIHNRSFFSDKQMIKLQESPEDM
PAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHY
RKTDAKRLHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGIL
LQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAV
GLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKA
GIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRR
LAHHLVSLYYQSEEQVEEEFLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVNMRKIG
SSRGMVSAYPRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREALKQSATDPRTGIV
DISILTTGMSATSRKRKEELAEALRKLILSKGKTPALKYQQLFEDIRGQSDTAITKDMFE
EALRALADDDFLTVTGKTVRLL
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccccggcatccaccccgagccgccgcagcagccgacgcggacgagtcacccca
acccagtcccttcgaagtgaggaaagcaggtcgtcacccaatcggagacgtagaggcgaa
gattcttccaccggagagctactgccaatgcccacctcaccaggagccgacctgcagagc
ccacctgcacagaatgccttgttttccagccctcctcagatgcattctttagctattcct
ttggactttgatgttagttcaccattgacatatggcactcccagctcgcgagtggaagga
accccaagaagtggggtgagaggcacacctgtaaggcagaggccagatctgggctcagca
cgaaagggtttgcaggtggatctgcagtctgatggcgcagcagcagaagacatcgtacca
agtgaacagtctctaggccaaaagcttgtgatttggggaacagatgtgaatgtggcaaca
tgtaaagagaattttcagagattccttcagtgttttactgatcctctggccaaagaagaa
gaaaatgttggcatagatattactcaacctttgtacatgcaacaacttggagagattaat
attacaggagagccatttttaaatgtgaactgcgaacacataaaatcatttagcaaaaat
ctgtatagacagctcatctcctacccacaggaggttataccaacctttgacatggctgtc
aatgagatcttctttgaccgttatcctgactccatcttagaacatcagattcaagtcaga
ccttttaatgcgttgaagacaaagagtatgagaaacttgaatccagaagacattgatcag
ctcatcaccatcagtggcatggtcatcagaacatcacagctgattccggagatgcaggag
gcctttttccaatgccaagtctgtgcccacaccacccgggtggagatagatcgaggcaga
attgctgagccctgcagttgtgtgcactgccacactacccacagcatggcactgatccac
aaccgatcattcttctctgacaagcaaatgatcaaacttcaagagtctcctgaagacatg
cctgctgggcagacacctcacactattgtcctttttgcccacaatgaccttgttgacaag
gttcaaccaggggacagagtgaacgtcacaggcatatatcgagcagtaccaattcgagtt
aatccaagagtgagcaacgtgaagtctgtctataaaacccacattgatgtcattcattat
cggaaaacggatgcaaaacgtctgcatggccttgatgaagaagcagaacagaaacttttt
tcagagaaacgtgtgaaattgcttaaggaactttccaggaagccagatatttatgagcgg
cttgcttcagccttggctcccagcatttatgaacatgaagatatcaaaaagggaatctta
cttcagctctttggtggaacaaggaaggatttcagtcacactgggaggggtaaattccgt
gctgagatcaacatccttctgtgtggggaccctggcaccagcaagtcccagctgctacag
tatgtgtacaacctggtccccagaggccagtacacgtctggaaaaggctccagtgcggtc
ggcctcaccgcctatgtgatgaaagaccctgagaccaggcagcttgtcctccagacaggt
gccctcgtcctgagtgacaatgggatatgctgcatcgatgagtttgacaaaatgaatgaa
agcacaaggtctgtgctgcatgaggtcatggaacagcagactctgtccattgcaaaggct
gggatcatctgtcagctcaatgcgcgcacctctgtcctggcagcagcaaatcctattgag
tctcagtggaatcctaaaaaaacaaccattgaaaatatccaactaccgcacacattgttg
tcaaggtttgatctcattttcctcatgctagaccctcaggatgaggcatatgaccggcgt
ctagctcatcacctggtttcattgtactaccaaagtgaggagcaagtggaggaggagttc
ctggacatggccgtgctgaaagactacattgcatatgcccatagtaccatcatgccccga
ctgagtgaggaggccagccaggctctcattgaggcttatgtaaacatgaggaagattggg
agtagccgggggatggtttctgcttaccctcgacagctagagtcattaattcgcttagca
gaagcccatgctaaagtaagattttcaaacaaagttgaagcaattgatgtggaagaggca
aaacgcctccaccgggaggctctgaagcagtctgcaactgaccctcgtactggcattgtg
gatatttctattcttactacaggaatgagtgccacttctcgtaaacggaaagaagaatta
gctgaagcattgagaaaacttattttatctaagggtaaaacaccagccttaaagtaccaa
cagctgtttgaggatattcggggacagtctgacacagcaattaccaaggacatgtttgaa
gaagccctgcgagctttggctgatgatgatttcctaacagtgactgggaagactgtccgc
ctgctctga

DBGET integrated database retrieval system