KEGG   Mus musculus (mouse): 17250Help
Entry
17250             CDS       T01002                                 

Gene name
Abcc1, Abcc1a, Abcc1b, MRP, Mdrap, Mrp1
Definition
(RefSeq) ATP-binding cassette, sub-family C (CFTR/MRP), member 1
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu02010  ABC transporters
mmu04071  Sphingolipid signaling pathway
mmu04977  Vitamin digestion and absorption
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    17250 (Abcc1)
  Signal transduction
   04071 Sphingolipid signaling pathway
    17250 (Abcc1)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    17250 (Abcc1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    17250 (Abcc1)
  Drug resistance
   01523 Antifolate resistance
    17250 (Abcc1)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    17250 (Abcc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 RsgA_GTPase AAA_25 AAA_29 AAA_22 Zeta_toxin ABC_ATPase Dynamin_N
Motif
Other DBs
NCBI-GeneID: 17250
NCBI-ProteinID: NP_032602
MGI: 102676
Ensembl: ENSMUSG00000023088
Vega: OTTMUSG00000027051
UniProt: O35379 A5D6P3
Position
16; 16 A1
AA seq 1528 aa AA seqDB search
MALRSFCSADGSDPLWDWNVTWHTSNPDFTKCFQNTVLTWVPCFYLWSCFPLYFFYLSRH
DRGYIQMTHLNKTKTALGFFLWIICWADLFYSFWERSQGVLRAPVLLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAHVDVFRDSTFYLYFT
LVLVQLVLSCFSDCSPLFSETVHDRNPCPESSASFLSRITFWWITGMMVHGYRQPLESSD
LWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEA
LIVKSPHKDREPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAP
DWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSST
VGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPL
NAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVL
KKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNIL
PMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQND
SLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIV
MSGGKISEMGSYQELLDRDGAFAEFLRTYANAEQDLASEDDSVSGSGKESKPVENGMLVT
DTVGKHLQRHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQVQLSVYW
NYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGTQANRNFRLSVYGALG
ILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTV
DSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRL
ESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRL
ECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVER
LKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKV
GIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGS
LRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARA
LLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKG
EVRECGAPSELLQQRGIFYSMAKDAGLV
NT seq 4587 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgcagcttctgcagcgctgatggctccgatccactctgggactggaatgtc
acatggcacaccagcaaccccgactttaccaagtgctttcagaacacggtcctcacatgg
gtgccttgtttctacctctggtcctgtttccccctctacttcttctatctctctcgccat
gaccggggctacatccagatgacacacctcaacaaaaccaaaactgccttaggattcttt
ctgtggatcatctgctgggcagacctcttctactctttctgggaaagaagtcagggagtg
ctccgagccccagtgttactggtcagcccaacactgctgggcatcaccatgctgctcgcc
acctttttgatacagcttgaacggaggaagggagtccaatcctcgggaattatgcttact
ttctggctcgtagccctactctgtgcccttgccatcttgagatctaagatcatctctgcc
ttaaaaaaggatgctcatgtggacgtgtttcgagattccacgttctatctgtacttcacc
cttgtgcttgttcagctcgtgctgtcctgcttctcagactgctcacccctgttctctgaa
actgtccatgaccggaatccatgcccagaatccagtgcctctttcctttccaggattact
ttctggtggattacagggatgatggtgcacggctaccgccagcccctggagagcagtgac
ctctggtcattgaataaggaggacacatcagaagaagtggtacctgtgctggtgaataac
tggaagaaggaatgtgataagtcaaggaagcagcctgtacggattgtgtatgcccctccc
aaagatcccagcaagcctaagggaagttcccagttggatgtgaatgaggaggtggaggca
ctgattgtcaagtcaccccacaaggatcgggagccctctctgttcaaggtgttatacaag
acttttggtccctacttcctcatgagcttcctgtacaaggcccttcatgacctgatgatg
tttgccggccccaagatcttggaattgattatcaacttcgtgaatgacagggaggctccc
gactggcagggctacttttacacagcactgctgtttgtcagcgcctgtctgcagacactg
gcactccaccagtactttcatatctgcttcgtcagtggcatgcgcatcaagactgctgtg
gtgggcgctgtctatcgtaaggctcttttgatcaccaatgcagctagaaaatcttccacg
gtcggagagattgtcaacctcatgtccgtggatgctcagcgcttcatggacttggccacg
tacattaacatgatctggtcagcccctctgcaagtcatcctagccctctacttcctgtgg
ctgagcctgggcccttctgtgctggctggagtggctgtgatgattctcatggtaccctta
aatgctgtgatggccatgaagaccaagacctaccaggtggcacacatgaagagcaaagac
aaccgaatcaagctgatgaacgagatcctcaatgggatcaaagtcctcaagctgtacgcc
tgggagctggccttccaggacaaagtcatgagcatcaggcaggaggagctcaaggtgctg
aagaaatctgcctacttggcagctgtaggcacattcacgtgggtgtgcacacctttcctg
gtggccctgtcaacctttgctgtctttgtgactgtggatgagagaaatatcctagatgca
aagaaagcctttgtgtccctagccctgttcaatatcttgcgcttcccactcaacatcctg
cccatggttatcagcagcattgtgcaggccagcgtgtccctcaagcgtctcaggattttt
ctgtctcatgaggagctggagccagacagcattgagcggaggtcgatcaagagtggcgaa
gggaatagcatcactgtgaagaatgcaaccttcacttgggccaggggtgaacctcccaca
ctgaatggcatcaccttctccattcctgaaggagcccttgtggccgtggtgggccaggta
ggctgcgggaagtcatctctgctgtcagccctgctggctgagatggacaaggtggaggga
catgtgactctcaagggctccgtggcctacgtgccccagcaggcctggattcagaatgac
tctctccgagagaacatactgtttgggcaccccctgcaggaaaattactacaaggcagtt
atggaagcctgtgcccttcttccagatttggaaatcctgcccagtggggaccgcacagag
atcggtgagaagggtgtgaacctgtcagggggccagaagcagcgtgtgagcctggcccgg
gctgtgtactctaactctgacatctacctctttgatgaccccctctcggctgtggatgca
catgttgggaagcacatctttgagaaggtggttggtcccatgggcctactgaagaacaag
acacggatcctggtcacccatggtatcagctacctgccccaagtggatgtcatcattgtc
atgagtggcggcaagatctcagagatgggttcttatcaggagctgctagaccgggatggg
gccttcgctgagttcctgcgcacctatgccaacgctgagcaggacctggcctcggaggat
gacagtgtcagtggttcagggaaggagtcaaagccggtggaaaatgggatgctggtgaca
gacaccgtaggaaagcacctgcagaggcatctcagcaactcgtcttcccacagtggggat
accagccagcaacacagcagcatagccgaactgcagaaggctggagctaaggaggagacg
tggaagctaatggaagcagacaaggcccagacagggcaggtgcagctgtcagtgtactgg
aactacatgaaggccattggcctcttcatcaccttcttgagtatcttccttttcctgtgc
aaccatgtatctgcactggcctctaactattggctgagcctctggacagatgacccccct
gttgtcaatgggactcaggcgaacaggaattttcggctgagtgtctatggggccttgggc
atcttgcaaggtgcagcaatatttggctactccatggctgtgtccatcgggggcatcttt
gcctcccgtcgcttgcacctggacctgctatacaatgttctgcgatcacccatgagtttc
tttgagcgtacacccagtgggaacctagtgaaccgattctccaaggagctggacacagtg
gactccatgatcccgcaggtcatcaagatgttcatgggttcactcttcagtgtcattgga
gctgtcatcatcatcctactggccacgcccattgccgcagtcatcatcccacccttgggt
ctggtttacttctttgtgcagaggttctatgtggcttcctcaagacaactgaagcgcctg
gagtctgtcagccgttcccctgtgtactcacacttcaatgagaccttgctgggagtcagt
gtcatccgtgcttttgaggagcaggagcgcttcattcaccagagtgacctgaaagtagat
gagaaccagaaggcctactaccccagcattgtggccaacaggtggcttgctgtgcgcctt
gagtgtgtgggcaactgcattgtgctgtttgctgccctctttgcagtcatctcccggcac
agcctcagtgctggcttggtgggcctctctgtgtcttactcactgcagataactgcatac
ttgaactggctggttcgaatgtcctcggagatggagaccaacattgtggcagtggagaga
ctgaaggagtattctgaaacagagaaggaggctccttggcaaatccaggaaacagctcca
cccagcacctggccccattcaggccgtgtagagttccgggattactgcctgaggtatcga
gaagacttggacttggttctcaagcacataaatgtcaccattgagggtggagaaaaggtg
ggtattgtaggtcgtacgggagctgggaaatcatctctcaccctgggtttgttccggatc
aatgagtctgcagaaggggagatcatcattgatggggtcaacatcgccaagatcggcctg
cacaacctgcgcttcaagatcaccatcattccacaggatcctgttttgttctcgggttcc
ctccgcatgaacttggaccctttcagtcagtattctgatgaagaagtctggatggccctg
gagcttgctcacctaaagggctttgtgtcagctttgcctgacaagctgaaccatgagtgt
gcagaaggtggagagaacctgagtgtggggcagcgacagcttgtgtgcctggcccgggct
ctgctgaggaagacaaagattctagtgttggacgaggctaccgcagctgtggacctagag
acagataaccttatccagtccaccatccggacacagtttgaagactgtactgtgctcacg
attgctcatcggcttaacaccataatggactacacgcgggtgattgtcctggacaaagga
gaagttcgggagtgtggtgcaccctctgagctcctgcagcaaagaggcatcttctacagc
atggccaaggatgctggcttggtgtga

DBGET integrated database retrieval system