KEGG   Mus musculus (mouse): 17279Help
Entry
17279             CDS       T01002                                 

Gene name
Melk, AI327312, MPK38, mKIAA0175
Definition
(RefSeq) maternal embryonic leucine zipper kinase (EC:2.7.11.1 2.7.10.2)
  KO
K08799  
maternal embryonic leucine zipper kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17279 (Melk)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   17279 (Melk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4 B1; 4 23.46 cM
AA seq 643 aa AA seqDB search
MKDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDA
LKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAV
AYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELI
QGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLL
QQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSKTPLTHLDEDCVTELSVHHRSSRQT
MEDLISSWQYDHLTATYLLLLAKKARGKPARLQLLSFSCGTASTTPKSKNLSLEDMSTSD
DNCVAGLIDYELCEDKLLAPKTPQVTKHLAESNHAASKSPAPGVRRAVANKLMDKENVCT
PKSSVKNEEQFVFSEPKIPVSKNQYKREIPASPTRFPTPAKARAQCLREAPVRTPGNSAG
ADTLTTGVISPERRCRSMDVDLNQAHMEDTPKKKGTNVFGSLERGLDKVLTALTRNKKKG
SARDGPRKRKLHYNVTTTRLVNPDQLLSEIMAILPKKNVDFVQKGYTLKCQTQSDFGKVT
MQFELEVCQLQRPDVVGIRRQRLKGDAWVYKRLVEDILSGCKM
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattatgacgaactcctcaaatactatgaactatatgaaacgattgggacaggt
ggctttgcaaaggtcaaactggcctgccatgtcctcactggagagatggtagctataaaa
atcatggataagaatgcgctagggagtgatttgccccgagtcaaaactgagatcgatgcg
ctgaagagtctgagacatcagcacatatgtcagctctaccatgtgctggagacaaagaac
aaaatattcatggttctggagtactgtccaggaggagagctgtttgactacataatctcc
caggatcgcctgtcggaagaggagacccgggtcgtcttccgtcagatactgtctgcagtt
gcgtatgtccacagccagggctatgcccacagggacctcaaaccagaaaatttattattt
gatgaaaatcataagctaaagctgattgactttggtctttgtgcaaaacccaagggcaac
aaggactaccatctgcagacgtgctgtgggagccttgcttatgcagctcctgaactaata
caagggaagtcgtaccttggatcagaggcagatgtttggagcatgggcatcctcctgtat
gtgctcatgtgtggatttctaccatttgatgatgataatgtcatggctttgtacaagaag
ataatgagagggaaatacgaagttcctaagtggctctctcccagtagcattctgcttctc
cagcagatgttgcaggtggacccaaagaaacggatttctatgagaaatctcctgaaccat
ccctgggtcatgcaagattacagctgtcccgtggagtggcaaagcaagactcctttgact
cacctcgatgaggattgcgtgacagagctttctgtacatcaccgcagcagcaggcagaca
atggaggatttaatttcgtcgtggcagtacgatcacctcacagccacctaccttctgctt
ctagccaagaaggcccgggggaagccggctcgtctacagctcctgtccttctcttgtgga
accgccagcaccactccaaagtcaaagaatctgagcctggaagatatgagcacaagtgat
gataactgtgtggctggattgatagactatgaattgtgtgaagataaattattagctccc
aagacgccacaggttaccaaacacttggcagaatcaaatcacgcagcatctaaatcacca
gcgccaggggtacgcagagcagtggcaaataaattaatggacaaagaaaatgtgtgcact
cccaagtcttctgtgaagaatgaagagcagtttgtattttctgagccgaagattccagtt
agtaagaaccagtataagagagaaatacccgcctcaccaacccgtttcccaacacctgca
aaagctagagcccagtgcctgagagaagccccggttagaacaccagggaattccgcagga
gcagacacactaacgacaggtgtcattagccccgagaggaggtgccgttcaatggacgtg
gatctcaaccaggcacacatggaggataccccgaaaaagaaaggaaccaatgtgtttggg
agccttgagagaggactggataaggttctcactgcgctcacaaggaacaagaagaagggc
tctgccagagatggaccaagaaagcgaaagctgcactacaatgtgactacaactcgcctg
gtgaaccccgaccagctcctgagcgaaatcatggctattcttccaaagaagaacgtggac
ttcgtacagaaaggttacactctaaagtgtcaaacgcagtctgattttggcaaagtgaca
atgcagtttgaactggaagtgtgccagctgcagagacctgacgtggtaggcatccggaga
cagcggctgaagggtgatgcctgggtttacaagagattagtggaagatatcttgtctggc
tgcaagatgtga

DBGET integrated database retrieval system