KEGG   Mus musculus (mouse): 17295Help
Entry
17295             CDS       T01002                                 

Gene name
Met, AI838057, HGF, HGFR, Par4, c-Met
Definition
(RefSeq) met proto-oncogene (EC:2.7.10.1)
  KO
K05099  
proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Axon guidance
Focal adhesion
Adherens junction
Bacterial invasion of epithelial cells
Malaria
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Melanoma
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    17295 (Met)
   04015 Rap1 signaling pathway
    17295 (Met)
   04151 PI3K-Akt signaling pathway
    17295 (Met)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    17295 (Met)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    17295 (Met)
  Cellular commiunity
   04510 Focal adhesion
    17295 (Met)
   04520 Adherens junction
    17295 (Met)
 Organismal Systems
  Development
   04360 Axon guidance
    17295 (Met)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    17295 (Met)
   05230 Central carbon metabolism in cancer
    17295 (Met)
   05202 Transcriptional misregulation in cancers
    17295 (Met)
   05206 MicroRNAs in cancer
    17295 (Met)
   05205 Proteoglycans in cancer
    17295 (Met)
   05218 Melanoma
    17295 (Met)
   05211 Renal cell carcinoma
    17295 (Met)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    17295 (Met)
   05144 Malaria
    17295 (Met)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    17295 (Met)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     17295 (Met)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Met family
   17295 (Met)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class VI (HGF receptor family)
   17295 (Met)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class VI (HGF receptor family)
   17295 (Met)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 A2; 6 7.83 cM
AA seq 1379 aa AA seqDB search
MKAPTVLAPGILVLLLSLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGH
HIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCRDCSSKANSSGGVWKDNINMAL
LVDTYYDDQLISCGSVNRGTCQRHVLPPDNSADIQSEVHCMFSPEEESGQCPDCVVSALG
AKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
QDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDILFGVFAQSKPDSAEPVNRSA
VCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSDEYRTEFT
TALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHLTPHVNFLL
DSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWC
HNQCVRFDECPSGTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKT
KVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIISNSRETTQYSAFSYVDPVITS
ISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTSDEFP
VKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLNSVSLPKLVIDVHE
VGVNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVF
EPFEKPVMISIGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLL
KLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLLSGLFLWMRKRKHK
DLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACR
QVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNE
VIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP
KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT
NT seq 4140 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcccaccgtgctggcacctggcattctggtgctgctgttgtccttggtgcag
aggagccatggggagtgcaaggaggccctagtgaagtctgagatgaacgtgaacatgaag
tatcagctccccaacttcacggcagaaacccccatccagaatgtcgtcctacacggccat
catatttatctcggagccacaaactacatttatgttttaaatgacaaagaccttcagaag
gtatccgaattcaagaccgggcccgtgttggaacacccagattgtttaccttgtcgggac
tgcagcagcaaagccaattcatcaggaggggtttggaaagacaacatcaacatggctctg
cttgttgacacatactatgatgatcaactcattagctgtggcagtgtcaacagagggact
tgccagcggcatgtccttcctcctgacaattctgctgacatccagtctgaggtccactgc
atgttctccccagaagaggagtcagggcagtgtcctgactgtgtagtgagtgccctcgga
gccaaagtcctcctgtcggaaaaggaccggttcatcaatttctttgtggggaatacgatc
aattcctcctatcctcctggttattcactgcattcgatatcggtgagacggctgaaggaa
acccaagatggttttaagtttttgacagaccagtcctatattgatgtcttaccagaattc
caagattcctaccccataaagtacatacatgccttcgaaagcaaccattttatttacttt
ctgactgtccaaaaggaaactctagatgctcagacttttcatacaagaataatcaggttc
tgttccgtagactctgggttgcactcctacatggaaatgcccctggaatgcatcctgaca
gaaaaaagaaggaagagatccacaagggaagaagtgtttaatatcctccaagccgcgtat
gtcagtaaaccaggggccaatcttgctaagcaaataggagctagcccttctgatgacatt
ctcttcggggtgtttgcacaaagcaagccagattctgctgaacctgtgaatcgatcagca
gtctgtgcattccccatcaaatatgtcaatgacttcttcaacaagattgtcaacaaaaac
aacgtgagatgtctccagcatttttacggacccaaccatgagcactgtttcaataggacc
ctgctgagaaactcttccggctgtgaagcgcgcagtgacgagtatcggacagagtttacc
acggctttgcagcgcgtcgacttattcatgggccggcttaaccaagtgctcctgacatcc
atctccaccttcatcaaaggtgacctcaccattgctaatctagggacgtcagaaggtcgc
ttcatgcaggtggtgctctctcgaacagcacacctcactcctcatgtgaacttcctcctg
gactcccatcctgtatctccagaagttattgttgagcatccatcaaatcaaaatggctat
acattggttgtcacaggaaagaagatcaccaagattccattgaatggcctgggctgtgga
catttccaatcctgcagtcagtgcctctctgccccttactttatacagtgtggctggtgc
cacaatcaatgtgtgcgttttgatgaatgccccagcggtacatggactcaagagatctgt
ctgccggcggtttataaggtgttccccaccagcgcgccccttgaaggaggaacagtgttg
accatatgtggctgggactttggattcaggaagaataataaatttgatttaaggaaaacc
aaagttctgcttggcaacgagagctgtaccttgaccttaagcgagagcacgacaaatacg
ttgaaatgcacagttggtcccgcgatgagtgagcacttcaatgtgtctgtaattatctca
aacagtcgagagacgacgcaatacagtgcattctcctatgtagatcctgtaataacaagc
atttctccgaggtacggccctcaggctggaggcaccttactcactcttactgggaaatac
ctcaacagtggcaattctagacacatttcaattggagggaaaacatgtactttaaaaagt
gtatcagatagtattcttgaatgctacaccccagcccaaactacctctgatgagtttcct
gtgaaattgaagattgacttggctaaccgagagaccagcagcttcagttaccgggaagac
cccgttgtctatgaaatccacccgaccaaatcttttattagtggtggaagcacaataacg
ggtattgggaagaccctgaactcggttagcctcccaaagctggtaatagatgtgcatgaa
gtgggtgtgaactacacagtggcatgtcagcatcgctcaaattcagagatcatctgctgc
actactccttcactgaaacagctgggcctgcaactccccctgaagaccaaagccttcttc
ctgttagacgggattctttccaaacactttgatctcacttatgtgcataatcctgtgttt
gagccttttgaaaagccagtaatgatctcaataggcaatgaaaatgtagtggaaattaag
ggaaacaatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaatcagagc
tgcgagagtctccactggcactctggagctgtgttgtgtacagtccccagtgacctgctc
aaactgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgttcttgga
aaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgcggtctcaata
tcagtagtagttttgttattatccgggctcttcctgtggatgagaaagagaaagcataaa
gatctgggcagtgaattagttcgctatgacgcaagagtacacactcctcatttggatagg
cttgtaagtgcccgaagtgtaagtccaactacagagatggtttcaaatgagtctgtagac
tacagagctacttttccagaagaccagtttcccaactcctctcagaatggagcatgcaga
caagtgcaataccctctgacagacctgtcccctatcctgacaagtggagactctgatata
tccagcccattactacaaaatactgttcacattgacctcagtgctctaaatccagagctg
gtccaagcagttcagcacgtagtgattggacccagcagcctgattgtgcatttcaatgaa
gtcataggaagagggcattttggctgtgtctatcatgggactttgctggacaatgacgga
aagaaaattcactgtgctgtgaaatccttaaatagaatcacagatatagaagaggtctcc
cagtttctgactgagggaatcatcatgaaagacttcagccatcccaatgttctctcactc
ttgggaatctgcctgaggagtgaagggtctcctctggtggtcctgccctatatgaagcat
ggagatctgcgaaatttcattcgaaacgagactcataatccaactgtgaaagatcttata
ggatttggccttcaagtagccaaaggcatgaaatatcttgccagcaaaaagtttgtccac
agagacttagctgcaagaaactgcatgttggatgaaaaattcactgtcaaggttgctgat
ttcggtcttgccagagacatgtacgataaagagtactatagtgtccacaacaagacgggt
gccaagctaccagtaaagtggatggctttagagagtctgcaaacgcagaagttcaccacc
aagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacgagaggagcccct
ccttatcccgacgtgaacacatttgatatcactatctacctgttgcaaggcagaagactc
ttgcaaccagaatactgtccagacgccttgtacgaagtgatgctaaaatgctggcacccc
aaagcggaaatgcgcccgtccttttccgaactggtctccaggatatcctcaatcttctcc
acgttcattggggaacactacgtccacgtgaacgctacttatgtgaatgtaaaatgtgtt
gctccatatccttctctgttgccatcccaagacaacattgatggcgaggggaacacatga

DBGET integrated database retrieval system