KEGG   Mus musculus (mouse): 17364Help
Entry
17364             CDS       T01002                                 

Gene name
Trpm1, 4732499L03Rik, AI606771, Ltrpc1, Mlsn1
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 1
  KO
K04976  
transient receptor potential cation channel subfamily M member 1
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   17364 (Trpm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 C; 7 34.61 cM
AA seq 1622 aa AA seqDB search
MGSMRKMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKRECIFVIPSTKDPNRCCCGQLTN
QHIPPLPSGAPSTTGEDTKQADTQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAMYIR
VSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTGAW
IFTGGVSTGVVSHVGDALKDHSSKSRGRLCAIGIAPWGMVENKEDLIGKDVTRVYQTMSN
PLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVGLVV
EGGPNVVSIVLEYLKEDPPVPVVVCDGSGRASDILSFAHKYCDEGGVINESLRDQLLVTI
QKTFNYSKSQSYQLFAIIMECMKKKELVTVFRMGSEGQQDVEMAILTALLKGTNASAPDQ
LSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPVDTKATEKEKKPPTATTKGRGKGKGKK
KGKVKEEVEEETDPRKLELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPR
LEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKSFR
TLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHEL
MVWAVLMKRQKMAVFLWQRGEECMAKALVACKLYKAMAHESSESELVDDISQDLDNNSKD
FGQLAVELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTD
MWMGRLRMRKNPGLKVIMGILIPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENVDANA
DAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDG
WPSPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISMFMVGAI
LRLQSQPYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLV
VLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLY
DEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRY
QLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERDRGLKLFLSDEELKKL
HEFEEQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEINERENFMKTSLQTVDL
RLSQLEELSGRMVSALENLAGIDRSDLIQARSRASSECEATYLLRQSSINSADGYSLYRY
HFNGEELLFEEPALSTSPGTAFRKKTYSFRVKDEDAKSHLDQPSNLHHTPGPSPPATPGR
SRLALEGPLSTELRPGSDPGISAGEFDPRADFKSTEAAPSLNAAGVTGTQLTVESTDSHP
LRESKLVRYYPGDPNTYKTMKSRSFVYTEGRKLVRGLSNWSAEYSSIMDQAWNATEWRCQ
VQRITRSRSTDIPYIVSEAASQDELEDEHRGSLLDPQISRSALTVSDRPEKENLLSVKPH
QTLGFPCLRSRSLHGRPRSAEPAPSKLDRAGHASSTSNLAVMSVVPEGQNTQQEKRSAET
EC
NT seq 4869 nt NT seq  +upstreamnt  +downstreamnt
atggggtccatgaggaagatgagcagctccttcaagcgtggttcaatcaagagctccaca
tcagggtcccagaagggtcagaaagcatggatagagaagacattttgcaaaagggaatgc
atctttgtaattcccagtacaaaagaccctaacagatgttgctgtggtcagctcactaac
cagcacatcccccctctgccgagtggggctcccagcacaacaggagaggacaccaagcag
gcagacacgcagtccgggaaatggtctgtcagcaaacacacccagagctacccaacagac
tcctatgggattcttgaattccagggtgggggttactccaataaagccatgtacatccga
gtctcctacgacaccaagccagattccctgctccacctcatggtgaaggactggcagctg
gagctcccgaagctcttgatatctgtgcacggaggcctccaaagcttcgagatgcagccc
aaactgaagcaggtgtttgggaaaggtctgatcaaggctgccatgaccacgggggcgtgg
atcttcaccgggggtgtgagcactggtgtcgtcagccatgtgggggatgccttgaaagac
cactcctccaagtccagaggccggctctgtgctataggaattgctccctggggcatggtg
gagaacaaggaagacctgattggaaaagatgtaacaagagtctatcagaccatgtccaac
cctctgagcaagctctctgtgctcaacaattcccacactcacttcatcttggctgacaac
ggcaccctgggcaagtatggtgctgaggtgaagcttcgaagacagctggaaaaacacatc
tccctgcagaagatcaacacaaggctgggccagggtgtacctgtcgtgggcctagtggta
gaaggtggtcctaacgtggtttctatcgtcctggagtatctcaaagaagaccctcctgtc
cctgtggtggtttgcgatggcagtggacgtgcctctgacattttgtccttcgcacacaaa
tactgcgacgaaggaggagtcataaacgagtccctgcgggaccagcttctagttaccatt
cagaaaacatttaattacagcaagtcccagtcgtatcagctgtttgcaattatcatggag
tgcatgaagaagaaagaactcgtcactgtgtttcggatgggttccgagggtcagcaagat
gtcgagatggcaattttaactgccttgctcaaaggaaccaacgcatcagctccagatcag
ctgagcttggccctggcttggaaccgggtcgacatagcgcgaagccagatcttcgtcttt
ggcccacactggccgccactgggaagcctggcccctcctgtggacaccaaagccacagag
aaggaaaagaagccacccacagccaccaccaaggggagaggaaaaggaaaaggcaagaag
aaaggcaaagtgaaagaggaagtggaggaagagacggacccccggaagcttgagctgctc
aactgggtgaatgccctggagcaagccatgctggatgctcttgtcctagatcgggtggac
tttgtaaagctcctgattgaaaacggagtgaacatgcagcatttcctcaccatcccgagg
ctggaggagctatacaacaccagactgggcccaccaaacacccttcatctgctggtgcgg
gatgtaaagaagagcaaccttccacctgattaccacatcagcctcattgatataggactg
gtgctggagtacctcatgggcggtgcctaccgctgcaactacactcggaaaagcttccgg
actctctacaacaacttgtttggccctaagaggccgaaagcacttaagcttctgggaatg
gaagatgatgaacccccagccaaaggcaagaagaaaaagaagaagaagaaagaggaagag
attgacatcgacgtggacgaccccgccgtgagtaggttccagtacccgttccatgagctc
atggtatgggccgtgctcatgaagcgccagaagatggcggtcttcctgtggcagcgtggg
gaagagtgcatggcgaaggccttggtggcctgcaagctctacaaggccatggcccacgag
tcctccgagagcgagctggtggatgacatctcccaggatctggacaacaattccaaagat
tttggccagctcgctgtggagctgttagaccagtcttacaagcacgatgagcaggttgcc
atgaaacttctgacctacgagctcaagaactggagcaactcaacctgcctgaagctggct
gtggcagccaagcaccgggacttcattgctcacacctgcagccagatgctgctgacagac
atgtggatgggaaggcttcgcatgaggaagaaccctggcctgaaggtcatcatggggatc
cttatcccacccaccatcttgtttttggaattccgtacatatgatgacttctcctatcaa
acatccaaggagaacgaagatggcaaagaaaaggaagaagagaatgtggatgcaaatgca
gatgctggctcgagaaagggggatgaggagaatgagcacaaaaagcagaggagcattccc
attggaacaaagatctgtgaattctataatgcgcccattgtcaagttctggttttacaca
atttcctacttgggctacttgctgctgttcaattatgtcatcctggtgcggatggatgga
tggccatcaccccaagaatggattgtcatctcctacattgtgagccttgcattggagaaa
atacgagagatcctcatgtcggaaccaggcaaactcagccagaaaatcaaagtgtggctc
caggagtactggaacatcacagacctcgtggccatctccatgttcatggttggggccatc
cttcgtctccagagccagccatacatgggctatggtcgggtcatctactgtgtggatatc
atcctctggtacatccgagtgttagacatctttggtgtcaacaaatatcttggtccctat
gtgatgatgattggaaagatgatgattgacatgctctactttgtggtcattatgctggtt
gtactgatgagttttggagtggctcggcaagccatcttgcatccggaggagaagccttcc
tggaaactggcccgaaacatcttctacatgccatactggatgatctacggagaggtgttt
gcagaccagatagacctctacgccatggaaatcaaccctccttgtggtgagaatctctat
gatgaggaaggcaagaggctccctccctgcatccctggtgcctggctcacacctgccctc
atggcctgttatctcctggtggccaatatcctgctggtcaacctactgattgctgttttc
aacaataccttctttgaagtcaagtcaatatccaatcaagtgtggaagttccagcgatac
cagctgatcatgacatttcatgacaggccggtcctgcccccaccaatgatcatcttaagt
cacatctatatcatcattatgcgcctcagcggtcgctgcagaaaaaagagagagggggac
caggaggagcgggaccgtgggttgaagttgttccttagcgacgaagaactgaaaaaactg
catgagtttgaggagcagtgcgtgcaggagcacttccgggaaaaggaggatgagcagcag
tcgtccagcgacgagcgcatccgggtcacaagcgagagggttgaaaatatgtcaatgaga
ttggaggaaatcaacgaaagagaaaatttcatgaaaacttctctgcagactgttgacctt
cggctctctcagctggaggagctatctggcaggatggtgagcgctctggagaatctggca
ggcatcgacaggtctgatctgatccaggctcgatctcgagcatcctccgaatgcgaggcc
acctacctgctgcggcagagcagcatcaacagtgccgacggctacagcttgtaccgctac
catttcaatggcgaggagcttctgtttgaggagcctgctctctccacttcgccagggaca
gcgttccggaaaaaaacctactcctttcgtgtgaaggatgaggatgcaaagtcgcacctg
gaccagcccagcaacctgcaccacacccctggccccagcccacctgccacgccaggccgc
agccggctcgcccttgaaggtcccttgagcacagagctgagacctggatcggaccctggc
atctccgcaggcgagttcgatccgcgggcggatttcaagagcacggaagctgcaccaagt
ctgaacgcagcgggtgttacaggcactcaactgactgtcgaaagcaccgattcccaccct
ctgcgggagagcaaactcgtgcgctactaccccggagaccctaacacctacaaaacaatg
aagtccagaagcttcgtctatactgaaggaagaaagctagtccgaggtcttagcaactgg
agtgcagagtacagttcaatcatggaccaagcatggaacgcgacagaatggagatgtcaa
gttcaaaggatcacgcgctcccgcagcacagacatcccatacatcgtgtccgaagcagcc
tcgcaagacgagcttgaagatgagcacagaggatctcttctggatcctcagatctcccgt
tcagccctcaccgtctccgacaggccagaaaaggaaaacttactctctgtgaagccacat
cagactttaggattcccctgcctacggtcaagaagtttacatggccgtcctaggagtgct
gagcccgctcctagcaaattagacagggcaggacatgccagcagcactagcaacttagca
gttatgtcagttgttccagagggacaaaacacccagcaagagaaaagaagcgcggaaact
gagtgctga

DBGET integrated database retrieval system