KEGG   Mus musculus (mouse): 17384Help
Entry
17384             CDS       T01002                                 

Gene name
Mmp10, AV377895, MMP-10, SL-2
Definition
(RefSeq) matrix metallopeptidase 10 (EC:3.4.24.22)
  KO
K01396  
matrix metalloproteinase-10 (stromelysin 2) [EC:3.4.24.22]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.22  stromelysin 2
     17384 (Mmp10)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17384 (Mmp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9; 9 A1
AA seq 476 aa AA seqDB search
MEPLAILALLSLPICSAYPLHGAVTQGHPSMDLAQQYLEKYYNFKKNEKQIFKRKDSSPV
VKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRIVN
YTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFYPFDGPGQS
LAHAYPPGPGFYGDVHFDDDEKWTLAPSGTNLFLVAAHELGHSLGLFHSDKKESLMYPVY
RFSTSPANFHLSQDDIEGIQSLYGAGPSSDATVVPVLSVSPRPETPDKCDPALSFDSVST
LRGEVLFFKDRYFWRRSHWNPEPEFHLISAFWPTLPSDLDAAYEAHNTDSVLIFKGSQFW
AVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKYWRFDETRHVMDKG
FPRQITDDFPGIEPQVDAVLHEFGFFYFFRGSSQFEFDPNARTVTHILKSNSWLLC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagccactagccatcctggcactgctgagcctaccaatctgctcagcgtatcctctg
catggggcagtgacacaaggccacccaagcatggatcttgctcagcaatacctagaaaaa
tactacaactttaaaaaaaatgagaaacaaattttcaaaagaaaggacagtagtcctgtt
gtcaaaaaaattcaagaaatgcagaagttcctcgggttggagatgacagggaagctggac
tccaacactatggagctgatgcacaagcccaggtgtggtgttcctgatgttggtggcttc
agtaccttcccaggttcgccaaaatggaggaaatcccacatcacctacaggattgtgaat
tatacaccagatttgccaagacagagtgtggattctgccattgagaaagctttgaaggtc
tgggaggaggtgaccccactcactttctccaggatctctgaaggagaggctgacataatg
atctcctttgcagttggagaacacggagacttttacccttttgatgggccaggacagagt
ctggctcatgcctacccacctggccctggattttatggagatgttcacttcgatgatgat
gagaaatggacacttgcaccctcagggaccaacttattcctggttgcagcccatgaactt
ggccactccctgggtctctttcattccgacaagaaagaatctctgatgtacccagtctac
aggttctccacaagcccagctaacttccacctttctcaagatgatatagagggcattcaa
tccctgtatggagccggtccctcctccgatgccacagtggttcctgtgttgtctgtctct
ccaagacctgagaccccagacaaatgtgatcctgctttgtcctttgattcagtcagcacg
ctgagaggggaagtcctattctttaaagacaggtacttctggcgcagatcccattggaat
cccgagcctgaatttcatttgatatcagcattttggcccactcttccttcagacttagat
gctgcctatgaggctcacaacacggacagtgttctgatttttaaaggaagtcagttctgg
gcagtccgaggaaatgaagtccaagcaggctacccaaaggggatccacactctcggtttt
cctcccaccgtgaagaagattgatgcagctgtttttgaaaaggagaagaagaaaacgtac
ttctttgtaggggacaaatactggagatttgatgagacaagacatgttatggataaaggc
ttcccaagacagataacagatgattttccaggaattgagccacaagttgatgctgtgtta
cacgaatttgggtttttttatttcttccgaggatcatcacagttcgagtttgaccccaat
gccaggacggtgacacacatactgaagagcaacagctggctgctgtgctga

DBGET integrated database retrieval system