KEGG   Mus musculus (mouse): 17385Help
Entry
17385             CDS       T01002                                 

Gene name
Mmp11, MMP-11, SL-3, ST3, Stmy3
Definition
(RefSeq) matrix metallopeptidase 11
  KO
K07993  
matrix metalloproteinase-11 (stromelysin 3) [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     17385 (Mmp11)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17385 (Mmp11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 C1; 10 38.62 cM
AA seq 492 aa AA seqDB search
MARAACLLRAISRVLLLPLPLLLLLLLLLPSPLMARARPPESHRHHPVKKGPRLLHAALP
NTLTSVPASHWVPSPAGSSRPLRCGVPDLPDVLNARNRQKRFVLSGGRWEKTDLTYRILR
FPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDFARYWHGDNLPFDGPGGI
LAHAFFPKTHREGDVHFDYDETWTIGDNQGTDLLQVAAHEFGHVLGLQHTTAAKALMSPF
YTFRYPLSLSPDDRRGIQHLYGRPQMAPTSPAPTLSSQAGTDTNEIALLEPETPPDVCET
SFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHWQGLPSPVDAAFEDAQGQIWF
FQGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGPEKNKIYFFRGGDYWRFHPRTQ
RVDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHLYWKFDPVKVKVLEGFPRPVGPD
FFDCAEPANTFR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcacgggccgcctgtctcctccgcgcgatttcgcgcgtcctcctgctcccgctgcct
ctgctgctcctgttgctgctgctcctgccgtcgccgctgatggcccgggccaggccaccg
gagagtcaccgtcatcaccctgtgaagaaagggcctcggctcctgcatgcagctctgcct
aataccttgacatctgtccccgcgtctcattgggtccctagtcctgccggtagctccagg
cctctacgatgtggtgtgcccgacctgcctgatgtactgaatgcccggaaccgacagaag
cgcttcgtcctgtcaggaggacgctgggagaagacagacctcacctataggatcctccgg
ttcccatggcagcttgtaagggagcaagtccggcagacagtggcagaggccctccaggta
tggagtgaagtgaccccactcactttcactgaggtgcacgagggacgcgctgacatcatg
atcgacttcgccaggtactggcatggtgacaacttgccgtttgacgggcctgggggcatc
ctggcccatgccttcttccctaagacccaccgagaaggggatgtccactttgactatgat
gaaacttggactattggggacaaccagggaactgacctgctgcaagtggcggctcatgaa
tttggccatgttctggggctacaacacaccacagcagctaaggccctcatgtcccctttc
tacaccttccgctaccctctgagccttagcccagatgaccgaaggggcatccagcacctc
tatgggcggccccagatggcccccacctcccccgccccaactttgagctcccaggctggg
acagataccaatgagattgcactgctggagccggaaaccccgccagatgtctgtgagact
tccttcgacgcggtttccaccatccgaggagagctcttcttcttcaaggcaggctttgtg
tggaggctgcgcagtgggcgactgcagcccgggtatcctgctttggcctctcggcactgg
caaggactgcccagccctgtggatgcagcttttgaggatgcccagggccagatttggttc
ttccaaggtgctcagtactgggtatatgatggtgagaagccagtcctaggccctgcacca
ctctccaagctgggcctgcaagggtccccagttcatgccgccttggtctggggtcctgag
aagaacaagatctacttcttccgaggtggagactattggcgtttccaccccagaacccag
cgagtggacaatcccgtgccccggcgctccactgactggcgaggggtaccttctgagatt
gatgctgccttccaggatgctgagggctatgcctacttccttcgtggccatctctactgg
aagtttgatcccgtgaaggtgaaggtcctagaaggctttcctcgccccgtaggtcctgac
ttctttgactgtgctgagcctgccaatactttccgctga

DBGET integrated database retrieval system