KEGG   Mus musculus (mouse): 17386Help
Entry
17386             CDS       T01002                                 

Gene name
Mmp13, Clg, MMP-13, Mmp1
Definition
(RefSeq) matrix metallopeptidase 13
  KO
K07994  
matrix metalloproteinase-13 (collagenase 3) [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     17386 (Mmp13)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17386 (Mmp13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9; 9 A1-A2
AA seq 472 aa AA seqDB search
MHSAILATFFLLSWTPCWSLPLPYGDDDDDDLSEEDLVFAEHYLKSYYHPATLAGILKKS
TVTSTVDRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGVPDVGEYNVFPRTLKWSQTNLT
YRIVNYTPDMSHSEVEKAFRKAFKVWSDVTPLNFTRIYDGTADIMISFGTKEHGDFYPFD
GPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGAL
MFPIYTYTGKSHFMLPDDDVQGIQFLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGE
TMIFKDRFFWRLHPQQVEAELFLTKSFWPELPNHVDAAYEHPSRDLMFIFRGRKFWALNG
YDILEGYPRKISDLGFPKEVKRLSAAVHFENTGKTLFFSENHVWSYDDVNQTMDKDYPRL
IEEEFPGIGNKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSILWC
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagctatcctggccaccttcttcttgttgagctggactccctgttggtccctg
ccccttccctatggtgatgatgatgatgatgacctgtctgaggaagaccttgtgtttgca
gagcactacttgaaatcatactaccatcctgcgactcttgcgggaatcctgaagaagtct
acagtgacctccacagttgacaggctccgagaaatgcaatctttctttggcttagaggtg
actggcaaacttgatgatcccaccttagacatcatgagaaaaccaagatgtggagtgcct
gatgtgggtgaatacaatgttttccctagaacactcaaatggtcccaaacgaacttaact
tacaggattgtgaactatactcctgatatgtcccattctgaagtggagaaggccttcaga
aaagccttcaaggtctggtctgatgtgacaccactgaatttcaccagaatctatgatggc
actgctgacatcatgatatcttttgggactaaagaacatggtgacttctacccatttgat
ggaccttctggtcttctggcacacgcttttcctcctggaccaaactatggtggggatgcc
cattttgatgatgatgaaacctggacaagcagttccaaaggctacaacttgtttattgtt
gctgcccatgagcttggccactccctaggtctggatcactccaaggacccaggagccctg
atgtttcccatctatacctacactggcaaaagccatttcatgcttcctgatgatgacgtt
caaggaattcagtttctttatggtccaggcgatgaagaccccaaccctaagcatcccaaa
acaccagagaagtgtgacccagccctatcccttgatgccattaccagtctccgaggagaa
actatgatctttaaagacagattcttctggcgcctgcaccctcagcaggttgaggctgag
ctctttttgacaaagtccttttggccagaacttcccaaccatgtggatgctgcatatgaa
catccatcccgtgaccttatgtttatctttagagggagaaaattctgggctctgaatggt
tatgacattctggaaggttatcccagaaaaatatctgacctgggattcccaaaagaggtg
aagagactgagcgctgcggttcactttgagaacacggggaagaccctcttcttctctgag
aaccacgtgtggagttatgatgatgttaaccagactatggacaaagattatccccgcctc
atagaagaggaattccctggaattggcaacaaagtagatgctgtctatgagaaaaatggc
tatatctactttttcaatgggcccatacagtttgaatacagtatctggagtaatcgcatt
gtgagagtcatgccaacaaattccatattgtggtgttaa

DBGET integrated database retrieval system