KEGG   Mus musculus (mouse): 17390Help
Entry
17390             CDS       T01002                                 

Gene name
Mmp2, Clg4a, GelA, MMP-2
Definition
(RefSeq) matrix metallopeptidase 2 (EC:3.4.24.24)
  KO
K01398  
matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
mmu  Mus musculus (mouse)
Pathway
Endocrine resistance
Leukocyte transendothelial migration
GnRH signaling pathway
Estrogen signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Proteoglycans in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    17390 (Mmp2)
  Endocrine system
   04912 GnRH signaling pathway
    17390 (Mmp2)
   04915 Estrogen signaling pathway
    17390 (Mmp2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    17390 (Mmp2)
   05205 Proteoglycans in cancer
    17390 (Mmp2)
   05219 Bladder cancer
    17390 (Mmp2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    17390 (Mmp2)
  Drug resistance
   01522 Endocrine resistance
    17390 (Mmp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     17390 (Mmp2)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17390 (Mmp2)
Cell adhesion molecules and their ligands [BR:mmu04516]
 2. Integrin Family
  Beta3 integrins
   VNR
    ITGB3; integrin beta 3 [KO:K06493]
     17390 (Mmp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 C5; 8 44.99 cM
AA seq 662 aa AA seqDB search
MEARVAWGALAGPLRVLCVLCCLLGRAIAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggaggcacgagtggcctggggagcgctggccggacctctgcgggttctctgcgtcctg
tgctgcctgttgggccgcgccatcgctgcaccatcgcccatcatcaagttccccggcgat
gtcgcccctaaaacagacaaagagttggcagtgcaatacctgaacactttctatggctgc
cccaaggagagttgcaacctctttgtgctgaaagataccctcaagaagatgcagaagttc
tttgggctgccccagacaggtgaccttgaccagaacaccatcgagaccatgcggaagcca
agatgtggcaacccagatgtggccaactacaacttcttcccccgcaagcccaagtgggac
aagaaccagatcacatacaggatcattggttacacacctgacctggaccctgaaaccgtg
gatgatgcttttgctcgggccttaaaagtatggagcgacgtcactccgctgcgcttttct
cgaatccatgatggggaggctgacatcatgatcaactttggacgctgggagcatggagat
ggatacccatttgatggcaaggatggactcctggcacatgcctttgccccgggcactggt
gttgggggagattctcactttgatgatgatgagctgtggaccctgggagaaggacaagtg
gtccgcgtaaagtatgggaacgctgatggcgagtactgcaagttccccttcctgttcaac
ggtcgggaatacagcagctgtacagacactggtcgcagtgatggcttcctctggtgctcc
accacatacaactttgagaaggatggcaagtatggcttctgcccccatgaagccttgttt
accatgggtggcaatgcagatggacagccctgcaagttcccgttccgcttccagggcacc
tcctacaacagctgtaccaccgagggccgcaccgatggctaccgctggtgtggcaccacc
gaggactatgaccgggataagaagtatggattctgtcccgagaccgctatgtccactgtg
ggtggaaattcagaaggtgccccatgtgtcttccccttcactttcctgggcaacaagtat
gagagctgcaccagcgccggccgcaacgatggcaaggtgtggtgtgcgaccacaaccaac
tacgatgatgaccggaagtggggcttctgtcctgaccaaggatatagcctattcctcgtg
gcagcccatgagttcggccatgccatggggctggaacactctcaggaccctggagctctg
atggccccgatctacacctacaccaagaacttccgattatcccatgatgacatcaagggg
atccaggagctctatgggccctcccccgatgctgatactgacactggtactggccccaca
ccaacactgggacctgtcactccggagatctgcaaacaggacattgtctttgatggcatc
gctcagatccgtggtgagatcttcttcttcaaggaccggtttatttggcggacagtgaca
ccacgtgacaagcccacaggtcccttgctggtggccacattctggcctgagctcccagaa
aagattgacgctgtgtatgaggccccacaggaggagaaggctgtgttcttcgcagggaat
gagtactgggtctattctgctagtactctggagcgaggataccccaagccactgaccagc
ctggggttgccccctgatgtccagcaagtagatgctgcctttaactggagtaagaacaag
aagacatacatctttgcaggagacaagttctggagatacaatgaagtgaagaagaaaatg
gaccccggtttccctaagctcatcgcagactcctggaatgccatccctgataacctggat
gccgtcgtggacctgcagggtggtggtcatagctacttcttcaagggtgcttattacctg
aagctggagaaccaaagtctcaagagcgtgaagtttggaagcatcaaatcagactggctg
ggctgctga

DBGET integrated database retrieval system