KEGG   Mus musculus (mouse): 17392Help
Entry
17392             CDS       T01002                                 

Gene name
Mmp3, EMS-2, MMP-3, SL-1, SLN-1, SLN1, STR-1, Stmy1, Str1
Definition
(RefSeq) matrix metallopeptidase 3 (EC:3.4.24.17)
  KO
K01394  
matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
mmu  Mus musculus (mouse)
Pathway
TNF signaling pathway
Transcriptional misregulation in cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    17392 (Mmp3)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    17392 (Mmp3)
  Immune diseases
   05323 Rheumatoid arthritis
    17392 (Mmp3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     17392 (Mmp3)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17392 (Mmp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 A1; 9 2.46 cM
AA seq 479 aa AA seqDB search
MKMKGLPVLLWLCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSS
LIVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRI
VNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFVPFDGPG
TVLAHAYAPGPGINGDAHFDDDERWTEDVTGTNLFLVAAHELGHSLGLYHSAKAEALMYP
VYKSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLVVPTKSNSLEPETSPMCSSTLFFDA
VSTLRGEVLFFKDRHFWRKSLRTPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGN
QFWAIRGHEELAGYPKSIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSM
EPGFPRKIAEDFPGVDSRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagggtcttccggtcctgctgtggctgtgtgtggttgtgtgctcatcctac
ccattgcatgacagtgcaagggatgatgatgctggtatggagcttctgcagaaataccta
gaaaactactatggccttgcaaaagatgtgaagcaatttattaagaaaaaggacagtagt
cttattgtcaaaaaaattcaagaaatgcagaagttcctcgggttggagatgacagggaag
ctggactccaacactatggagctgatgcataagcccaggtgtggtgttcctgatgttggt
ggcttcagtaccttcccaggttcgccaaaatggaggaaatcccacatcacctacaggatt
gtgaattatacaccggatttgccaagacagagtgtggattctgccattgaaaaagctttg
aaggtctgggaggaggtgaccccactcactttctccaggatctctgaaggagaggctgac
ataatgatctcctttgcagttggagaacatggagactttgtcccttttgatgggcctgga
acagtcttggctcatgcctatgcacctggaccagggattaatggagatgctcactttgac
gatgatgaacgatggacagaggatgtcactggtaccaacctattcctggttgctgctcat
gaacttggccactccctgggactctaccactcagccaaggctgaagctctgatgtaccca
gtctacaagtcctccacagacttgtcccgtttccatctctctcaagatgatgtagatggt
attcagtccctctatggaactcccacagcatcccctgatgtcctcgtggtacccaccaag
tctaactctctggaacctgagacatcaccaatgtgcagctctactttgttctttgatgca
gtcagcaccctccggggagaagtcctgttttttaaagacaggcacttttggcgcaaatct
ctcaggactcctgagcctgaattttatttgatctcttcattttggccatctcttccatcc
aacatggatgctgcatatgaggttactaacagagacactgttttcatttttaaaggaaat
cagttctgggctatacgagggcacgaggagctagcaggttatcctaaaagcattcacacc
ctgggtctccctgcaaccgtgaagaagatcgatgctgccatttctaataaagagaaaagg
aagacctacttctttgtagaggacaaatactggaggtttgatgagaagaaacaatccatg
gagccaggatttcccaggaagatagctgaggactttccaggtgttgactcaagggtggat
gctgtctttgaagcatttgggtttctctacttcttcagtggatcttcgcagttggaattt
gacccaaatgccaaaaaagtgacccacatattgaagagcaatagctggtttaattgttaa

DBGET integrated database retrieval system