KEGG   Mus musculus (mouse): 17394Help
Entry
17394             CDS       T01002                                 

Gene name
Mmp8, BB138268
Definition
matrix metallopeptidase 8 (EC:3.4.24.34)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     17394 (Mmp8)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17394 (Mmp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 A1; 9
AA seq 465 aa AA seqDB search
MFRLKTLPLLIFLHTQLANAFPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVA
EKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINH
TPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYA
YREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKD
KYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQG
YPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGV
NCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcctgaagacacttccattactgatcttcctccacacacagcttgccaatgcc
ttcccagtacctgaacacctggaagagaaaaatataaaaactgctgagaattacctacga
aaattctacaacttaccaagcaatcaattccggtcttcgaggaatgccacgatggttgca
gagaagcttaaagagatgcagcgcttcttcagcttagcagagactgggaagttagatgca
gctacaatggggattatggaaatgcctcgatgtggagtgcctgactctggtgatttcttg
ctaaccccaggaagtcccaagtggacacacactaacctgacctacaggattataaaccat
acgccacagctgtcaagggctgaagtgaaaacagcaattgagaaagcttttcacgtctgg
agtgtagcatcgcccctgaccttcaccgagatcttacagggagaagcagacatcaacatt
gctttcgtctcaagagaccatggtgacaattctccatttgatggacccaatggaatcctt
gcccatgcctttcaaccaggccaaggtattggaggagatgctcattttgattcagaagaa
acgtggactcaagattccaaaaattacaacctatttctcgtggctgctcatgaatttgga
cattctttgggactctctcactccactgatcctggtgccttgatgtacccaaactatgct
tacagggaacccagcacctattcactacctcaagatgatatcaatggcattcagacaatc
tatggaccttcagacaaccccatccaacctactgggcccagcacacccaaagcctgtgac
ccccacctgagatttgatgctactaccacactccgtggggagatttacttctttaaagac
aagtacttctggagacggcatcctcagctgagaacagttgacctcaatttcatatctctg
ttctggcccttcctacccaacggtcttcaggctgcttatgaagattttgacagagaccta
gttttcctatttaaaggcagacagtactgggctctaagtggctatgacctgcagcaaggt
taccccagagatatatccaactatggattcccaaggagtgtccaagccattgatgcagct
gtttcctataacgggaagacatacttcttcataaacaaccagtgctggagatatgacaat
caaagaagatccatggacccaggttaccccaaaagcataccaagcatgttcccaggagta
aactgtagagtcgatgcagttttcctgcaggactccttcttcctcttcttcagtggacca
caatattttgcatttaattttgtcagtcacagagtcactagagttgcaagaagcaattta
tggcttaactgttcatag

DBGET integrated database retrieval system