KEGG   Mus musculus (mouse): 17449Help
Entry
17449             CDS       T01002                                 

Gene name
Mdh1, B230377B03Rik, D17921, MDH-s, MDHA, Mor-2, Mor2
Definition
(RefSeq) malate dehydrogenase 1, NAD (soluble) (EC:1.1.1.37)
  KO
K00025  
malate dehydrogenase [EC:1.1.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Proximal tubule bicarbonate reclamation
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    17449 (Mdh1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    17449 (Mdh1)
   00620 Pyruvate metabolism
    17449 (Mdh1)
   00630 Glyoxylate and dicarboxylate metabolism
    17449 (Mdh1)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17449 (Mdh1)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    17449 (Mdh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     17449 (Mdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A3.1; 11 13.89 cM
AA seq 334 aa AA seqDB search
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKN
VIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKL
SSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKETAFEFLSSA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccaatcagagtccttgtgactggagcagctggtcaaattgcatattcactg
ttgtacagtattggaaatggatctgtctttgggaaagaccagcccatcattcttgtgctg
ttggacatcacccccatgatgggtgttctggacggtgtcctgatggaactgcaagactgt
gcccttccccttctgcaggatgtcattgcaacggacaaagaagagattgccttcaaagac
ctggatgtggctgtcctagtgggctccatgccaagaagggaaggcatggagaggaaggac
ctactgaaagccaatgtgaaaatcttcaaatcccagggcacagccttggagaaatacgcc
aagaaatcagttaaggtcattgttgtgggaaacccagccaatacgaactgcctgacagcc
tccaagtcagcgccatcgatccccaaggagaatttcagttgcctgactcgcttggaccac
aaccgagcaaaatctcaaattgctcttaaactcggtgtaaccgctgatgatgtaaagaat
gtcattatctggggaaatcattcatcgacccagtatccagatgtcaatcatgccaaggtg
aaactgcaaggaaaggaagtcggtgtgtatgaagccctgaaagacgacagctggctgaag
ggagagttcatcacgactgtgcaacagcgtggtgctgctgtcatcaaggctcggaagctg
tccagtgcaatgtctgctgcgaaagccatcgcagaccacatcagagacatctggtttgga
accccagagggagagttcgtgtcgatgggtgttatctctgatggcaactcctatggtgtc
cctgatgacctgctctactcattccctgtcgtgatcaagaataagacctggaagtttgtt
gaaggcctccccattaatgacttctcccgtgaaaagatggacctgacagcaaaggagctg
accgaggaaaaggagaccgcttttgagtttctctcctctgcgtga

DBGET integrated database retrieval system