KEGG   Mus musculus (mouse): 17451Help
Entry
17451             CDS       T01002                                 

Gene name
Mos, c-mos
Definition
(RefSeq) Moloney sarcoma oncogene
  KO
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    17451 (Mos)
  Cell motility
   04810 Regulation of actin cytoskeleton
    17451 (Mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    17451 (Mos)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17451 (Mos)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  MOS family
   17451 (Mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 A1; 4 2.16 cM
AA seq 343 aa AA seqDB search
MPSPLSLCRYLPRELSPSVDSRSCSIPLVAPRKAGKLFLGTTPPRAPGLPRRLAWFSIDW
EQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVNKCTKDLRASQRSFWAELNIARLRHDNI
VRVVAASTRTPEDSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSL
DVVNGLLFLHSQSILHLDLKPANILISEQDVCKISDFGCSQKLQDLRCRQASPHHIGGTY
THQAPEILKGEIATPKADIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAV
FTASLTGKTLQNIIQSCWEARALQRPGAELLQRDLKAFRGALG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcctctaagcctgtgtcgctacctccctcgtgagctgtcgccatcggtggac
tcgcggtcctgcagcattcctttggtggccccgaggaaggcagggaagctcttcctgggg
accactcctcctcgggctcccggactgccacgccggctggcctggttctccatagactgg
gaacaggtatgtctgatgcataggctgggctctggagggtttggctcggtgtataaagcc
acttaccacggtgttcctgtggccatcaagcaagtaaacaagtgcaccaaggacctacgt
gcatcccagcggagtttctgggctgaactgaacattgcaagactacgccacgacaacata
gttcgggttgtggctgccagcacgcgcacgcccgaagactccaacagcctaggtaccata
atcatggagtttgggggcaacgtgactctacaccaagtcatctacggtgccacccgctca
ccggagcctctcagctgcagagaacaactgagtttggggaagtgcctcaagtattcccta
gatgttgttaacggcctgctttttctccactcacaaagcattttgcacttggacctgaag
ccagcgaacattttgatcagtgagcaagacgtttgtaagatcagtgacttcggctgctcc
cagaagctgcaggatctgcggtgccggcaggcgtcccctcaccacatagggggcacgtac
acgcaccaagctccggagatcctgaaaggagagattgccacgcccaaagctgacatctac
tcttttggaatcaccctgtggcagatgaccaccagggaggtgccttactccggcgaacct
cagtacgtgcagtatgcagtggttgcctacaatctgcgcccctcactggcaggggcggtg
ttcaccgcctccctgactggaaagacactgcagaacatcatccagagctgctgggaggcc
cgcgccctgcagaggccgggtgcagaactgctccaaagggacctcaaggctttccgaggg
gcactaggctga

DBGET integrated database retrieval system