KEGG   Mus musculus (mouse): 17451Help
Entry
17451             CDS       T01002                                 

Gene name
Mos, c-mos
Definition
Moloney sarcoma oncogene (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    17451 (Mos)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    17451 (Mos)
  Cell growth and death
   04114 Oocyte meiosis
    17451 (Mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    17451 (Mos)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17451 (Mos)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  MOS family
   17451 (Mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 A1-A2; 4 2.16 cM
AA seq 343 aa AA seqDB search
MPSPLSLCRYLPRELSPSVDSRSCSIPLVAPRKAGKLFLGTTPPRAPGLPRRLAWFSIDW
EQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVNKCTKDLRASQRSFWAELNIARLRHDNI
VRVVAASTRTPEDSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSL
DVVNGLLFLHSQSILHLDLKPANILISEQDVCKISDFGCSQKLQDLRCRQASPHHIGGTY
THQAPEILKGEIATPKADIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAV
FTASLTGKTLQNIIQSCWEARALQRPGAELLQRDLKAFRGALG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcctctaagcctgtgtcgctacctccctcgtgagctgtcgccatcggtggac
tcgcggtcctgcagcattcctttggtggccccgaggaaggcagggaagctcttcctgggg
accactcctcctcgggctcccggactgccacgccggctggcctggttctccatagactgg
gaacaggtatgtctgatgcataggctgggctctggagggtttggctcggtgtataaagcc
acttaccacggtgttcctgtggccatcaagcaagtaaacaagtgcaccaaggacctacgt
gcatcccagcggagtttctgggctgaactgaacattgcaagactacgccacgacaacata
gttcgggttgtggctgccagcacgcgcacgcccgaagactccaacagcctaggtaccata
atcatggagtttgggggcaacgtgactctacaccaagtcatctacggtgccacccgctca
ccggagcctctcagctgcagagaacaactgagtttggggaagtgcctcaagtattcccta
gatgttgttaacggcctgctttttctccactcacaaagcattttgcacttggacctgaag
ccagcgaacattttgatcagtgagcaagacgtttgtaagatcagtgacttcggctgctcc
cagaagctgcaggatctgcggtgccggcaggcgtcccctcaccacatagggggcacgtac
acgcaccaagctccggagatcctgaaaggagagattgccacgcccaaagctgacatctac
tcttttggaatcaccctgtggcagatgaccaccagggaggtgccttactccggcgaacct
cagtacgtgcagtatgcagtggttgcctacaatctgcgcccctcactggcaggggcggtg
ttcaccgcctccctgactggaaagacactgcagaacatcatccagagctgctgggaggcc
cgcgccctgcagaggccgggtgcagaactgctccaaagggacctcaaggctttccgaggg
gcactaggctga

DBGET integrated database retrieval system