KEGG   Mus musculus (mouse): 17451Help
Entry
17451             CDS       T01002                                 

Gene name
Mos, c-mos
Definition
Moloney sarcoma oncogene (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mmu04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:mmu04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 A1-A2; 4 2.16 cM
AA seq 343 aa AA seqDB search
MPSPLSLCRYLPRELSPSVDSRSCSIPLVAPRKAGKLFLGTTPPRAPGLPRRLAWFSIDW
EQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVNKCTKDLRASQRSFWAELNIARLRHDNI
VRVVAASTRTPEDSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSL
DVVNGLLFLHSQSILHLDLKPANILISEQDVCKISDFGCSQKLQDLRCRQASPHHIGGTY
THQAPEILKGEIATPKADIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAV
FTASLTGKTLQNIIQSCWEARALQRPGAELLQRDLKAFRGALG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcctctaagcctgtgtcgctacctccctcgtgagctgtcgccatcggtggac
tcgcggtcctgcagcattcctttggtggccccgaggaaggcagggaagctcttcctgggg
accactcctcctcgggctcccggactgccacgccggctggcctggttctccatagactgg
gaacaggtatgtctgatgcataggctgggctctggagggtttggctcggtgtataaagcc
acttaccacggtgttcctgtggccatcaagcaagtaaacaagtgcaccaaggacctacgt
gcatcccagcggagtttctgggctgaactgaacattgcaagactacgccacgacaacata
gttcgggttgtggctgccagcacgcgcacgcccgaagactccaacagcctaggtaccata
atcatggagtttgggggcaacgtgactctacaccaagtcatctacggtgccacccgctca
ccggagcctctcagctgcagagaacaactgagtttggggaagtgcctcaagtattcccta
gatgttgttaacggcctgctttttctccactcacaaagcattttgcacttggacctgaag
ccagcgaacattttgatcagtgagcaagacgtttgtaagatcagtgacttcggctgctcc
cagaagctgcaggatctgcggtgccggcaggcgtcccctcaccacatagggggcacgtac
acgcaccaagctccggagatcctgaaaggagagattgccacgcccaaagctgacatctac
tcttttggaatcaccctgtggcagatgaccaccagggaggtgccttactccggcgaacct
cagtacgtgcagtatgcagtggttgcctacaatctgcgcccctcactggcaggggcggtg
ttcaccgcctccctgactggaaagacactgcagaacatcatccagagctgctgggaggcc
cgcgccctgcagaggccgggtgcagaactgctccaaagggacctcaaggctttccgaggg
gcactaggctga

DBGET integrated database retrieval system