KEGG   Mus musculus (mouse): 17761Help
Entry
17761             CDS       T01002                                 

Gene name
Map7, E-MAP-115, MAP-7, Mtap7, R75000, mshi, mste, ste
Definition
(RefSeq) microtubule-associated protein 7
  KO
K10433  
microtubule-associated protein 7
Organism
mmu  Mus musculus (mouse)
Brite
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     17761 (Map7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 A3; 10 9.75 cM
AA seq 730 aa AA seqDB search
MAEQGAGGDGHRGGDGATHSDPASDGYKVQEKRTAPSRPTSTVSGQTSNHSGNKPDPPPV
LRVDDRQRLARERREEREKQLAARETVWLEREERARQHYERHLEARKKKLEDQRLKEERR
RAAVEEKRRQRLEEDKERHEAVVRRTMERSQKPRQKSNRWSWGSPLHGSSSIHSGDPDRR
SVSTMNLSKHVDPVISKRLSSSSATLLNSPDRARRLQLSPWESSVVSRLLTPTHSFLARS
KSTAALSGDTASCSPIIMPFKAAHSRNPVDRPKLFVTPPEGSARRRTIHGLASHKRERER
EHVPFHVSPGARRTLSPSNLKARSPAPARLWLPSKSMPHLPGTPRPASSLPPGSVRAASA
QAPSSSPGNIRPVKREVKVEPEKKDPLPAVKSRVPLVKVEEVTVEEGTPVKPPEPAAPAS
APIATPAPAPATDPAPVPAPSSTVTVGVVPKTSAGTTDPEEATRLLAEKRRLAREQREKE
ERERKEKEELERQKIEELARRVAEERSRREEEARRLEEEQAREKEELALRLAEEERERWE
REEVERVQKQKEEEARAREEAERARQEREKHFQKEEQERLERKKRLEEIMRRTRRTETAD
KKTTEQRNGDIAKGVLTGEPEVPALPCMASSGNGESAESPHGVALQQSEVTTESSPDLEK
QPNENGMSIQNENFEEVINLPVGSKASRLDVTNENPEIPLKPILAFNDEGTLGPLPQVDG
VQTQQTAEVI
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcagggagctggcggcgacggccacaggggcggcgacggcgctacgcacagc
gacccagcgtctgatggctataaagtacaagagaagagaactgcccccagccgccccact
tctacagtttcaggacaaactagcaaccactcaggaaacaaaccagatcccccacctgtg
ctacgggttgatgaccggcagcggctagccagagaacgccgagaggaacgagaaaaacag
ctagctgcacgagaaaccgtctggctagagagagaagaacgagcccggcagcactatgag
agacatctggaggcgaggaagaagaagctggaggaccaacggctgaaggaggagcggagg
agggctgcggtggaggagaagcggaggcagaggctggaggaggacaaggagcgccatgaa
gctgttgtccgacggacgatggaaaggagccagaagccaaggcagaagtctaaccgctgg
tcctggggaagccctctccatgggagctcgagcatccacagtggagatccagacaggcgc
tcagtttccaccatgaatctttcgaaacatgttgatcctgtcattagcaagcggctctcc
tcctcgtctgcaactttgctaaactctccagatagagctcgccgcctgcagctcagcccc
tgggagagcagcgttgttagcagacttctgacgcccacacattcgttcctggccagaagc
aaaagcacggccgccttgtctggagacacagcatcttgcagccccatcatcatgcccttc
aaagctgcacactctagaaacccagtggaccgaccaaaactctttgtaacaccgcctgag
ggctctgcacgaaggaggaccattcatggactagcgagccataaaagagagcgagaaaga
gaacacgttcccttccacgtttccccgggcgcccgcaggactctgtctccatctaatctc
aaagcgaggtcaccggctccagcccgcctttggctcccatccaagtccatgcctcatctg
cctggtactccccggcctgcatcctccttgcctcccggctcagtcagagctgcttccgct
caggccccctcctcctctcctggcaacatccggcctgtcaagagagaagtgaaagtggag
cctgagaagaaagaccctttacccgcagtaaagagcagggtgccattagtgaaggtagag
gaggtcacagtcgaagaggggacacccgtgaagccacctgagcctgctgctccagcctcg
gcccccattgcaaccccagcccctgctccagctacggacccggccccagtccctgcacca
tcatccactgtgactgtcggtgtagttcctaagacttctgcaggcaccaccgacccagag
gaggctacgaggttgctggctgagaagaggcgtctagccagagagcagagggagaaggag
gaacgggagaggaaggaaaaggaagagctggagagacaaaagatagaggaattggcccgt
agggtggctgaagagcgaagtcgcagggaagaagaagcccgcaggctggaagaggagcag
gctcgagagaaagaggagctggcgctgcgtctggctgaggaggagcgggagcggtgggag
agggaggaggtggagcgcgtgcagaagcagaaagaagaagaagcccgagcccgggaggag
gcagagagggctcggcaggaacgagagaagcatttccagaaagaagagcaggaacggctg
gagaggaagaagcgacttgaagagattatgagaagaaccaggaggacagagaccgctgat
aagaaaaccactgagcaaagaaatggtgacatagccaaaggagttctcactggagagcca
gaagtacctgcactgccgtgtatggcctcttcaggaaacggagagtctgcagagagccca
catggagtcgctttacagcaatcagaagtgaccacagagagttctccagatttggaaaaa
cagccaaatgaaaacggaatgtccatacaaaatgaaaattttgaagaagttataaactta
cctgttggatcaaaagcgtccagattagatgtcaccaatgagaacccagaaattcctttg
aaaccaattttggcctttaatgatgaagggacacttgggcccctacctcaggtggatggt
gtgcagacacaacagaccgcagaagttatatga

DBGET integrated database retrieval system