KEGG   Mus musculus (mouse): 17847Help
Entry
17847             CDS       T01002                                 

Gene name
Usp34, A530081C03Rik, Murr2
Definition
ubiquitin specific peptidase 34 (EC:3.4.19.12)
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A3.2; 11 14.29 cM
AA seq 3582 aa AA seqDB search
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPLSIDRECNEGNTERQK
SIEKKSNSTRTCNLTEEESSKSSDPFSLWNTDEKEKLLLCVAKIFQIQFPLYTAYKHNTH
PTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFL
IAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTV
KEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETS
IAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKH
CSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPGVHTEQTLYLASMLIKALWNNALAAKA
QLSKQSSFASLLNTNMPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGASDIEMD
EQLINRNKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQ
SAGSPGSEVQSEDIADIEALKEEEEEEEEEEEEEEEEDDEEEEDEEEDDDDDDDHGHNPA
KNTCGTELRNRKLENPAGICLGESQGTSERNGTNSGTGKDLVFNTEPLPSVDNRIRMLDA
CAHSEDPEHGISGEVSSAHLAQGSQEACITRSGDFLGETIGNELFNCRQFIGPQHHHHHH
HHHHHHHHHHHHHHHHHDGHMVDDMLSADDVSCSSSQVSAKSEKNMADFDGEESGCEEEL
VQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHKHQFSSNAVTDINLDNVCKKGNTLL
WDIVQDDDAINLSEGLINEAEKLLCSLVCWFTDRQIRMRFIEGCLENLGNNRSVVISLRL
LPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDNLVYYIQGIREGRQKHALYSHSAE
VQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVEDSECYDDALHWFLNQVRSKDQHA
MGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLARLATSAYDGGSNSELCGMDQFWG
IALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFISKCMESLMIASSSLEQESHSSLTV
IERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLPLRVVCQPAGLPDK
MTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQLQEFGQSSRKGEFPGGLMGPVRMIS
SGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNIPMLL
LLQEPHLTTLFDLLEMLASFKPPSGKVAVDDSESLKCEELHLHAENLSRRVWELLMLLPT
CPNMLTAFQNVSDEQSNDGLNWKELLKIKSAHKLLYALEIIEALGKPNRRIRRESTGSYS
DLYPDSDDSSEDQVENSKNSWTCKFVAAGGLQQLLEIFNSAILEPKEQESWTVWQLDCLA
CLLKLICQFAVDPSDLDLAYHDVFAWSGIAESHRKRTWPGKSRKAAGDHAKSLHIPRLTE
VFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHCCSLV
KSSLADSDHLQDWLKQLTLLIPETAVRHESCNGLYKLSLSGLDGGDSIHRSFLLLAASTL
LKFLPDAQALKPPRIDDYEEEPLLKPGCKEYFWLLCKLVDNIHIKDASQTTLLDLDALAR
HLADCIRSREILDHLDGSIEDDGLSGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLLFL
LPSLKDRRQPKCKSHSCRAAAYDLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWDYWP
HEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKM
FTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKVEEMSPELKNTVKS
LFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCS
HCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFL
MGKSDRKEGFKDVGDRSKDTESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNKW
YLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMEPEE
ENGREYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSCIPSTLPDPKAVSLM
TAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQILIK
CPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDASVEDIGGRSCVTRFVRT
LLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQ
VEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQTDMAA
LTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPF
FKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQN
MENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVV
LHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYLSFMTYCLISKTEKLMFSTYFMDLWNLF
QPKLSEPAIATNHNKQALLSFWYNVCADCPENIRLIVQNPVVTKNIAFNYILADHDDQDV
VLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLM
QLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVV
FNRGLILMTESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQ
WQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHS
NIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFF
SYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNC
IKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSEANCASLISTLIT
NLINQYQNLQSDFTNRVEISKASAALNGDLRALALLLSVHTPKQLNPALIPTLQELLNKC
RTCLQQRNSLQEQEAKERKTKDDEGATPVKRRRVSSDEEHTVDSCIGDIKTETREVLTPT
STSDNETRDSSIIDPGTEQDLPSPENSSVKEYRMEGPSSFSEDGSHIRSQHAEEQSNNGR
FDDCKEFKDHCSKDTTLAEDESEFPSTSISAVLSDLADLRSCDGQALSSQDPEAAVSLSC
GHSRGLISHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
NT seq 10749 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagaactgcgcagacctggtggaggtgttaaatgaaatatcagatatagaaggt
ggtgatggactacagctcagaaaggaacatactctcaaaatatttgcttatatcaattcc
tggactcagaggcaatgtctatgctgcttcaaggaatataagcatttggagatttttaac
caagtagtatgtgcacttattaatttagtcattgcccaagttcaagtgctccgggaccag
ctttgtaaacattgtactaccattaacatagattccacgtggcaagatgagagtaatcaa
gcggaagaaccactgagtatagatagagaatgtaatgaaggaaatacagaaagacaaaaa
tcaatagaaaaaaaatcaaactctacaagaacttgtaatctgactgaggaggaatcttca
aagagttctgatccttttagtttatggaatacagatgagaaggaaaaactattactatgt
gtagcaaaaatttttcaaattcaatttcccttatatactgcttacaagcataatactcat
cctactatagaggatatatcgacacaagaaagtaacatattaggggcattctgtgatatg
aatgatgtagaagtacccttgcatttgcttcgttatgtctgtctgttttgtgggaaaaat
ggcctttctctcatgaaggattgctttgaatatgggactcctgagacgttaccatttctt
atagcacatgcatttattacagttgtttctaatattaggatatggctacatatccctgct
gtcatgcagcacattattccttttagaacgtatgttatcaggtatttatgcaagctctct
gatcaggagttacgacagagtgcggctcgtaatatggctgacctaatgtggagtacagtg
aaagagccattggatacaacactgtgctttgataaggaaagtctagaccttgcatttaaa
tactttatgtcaccaactctgaccatgaggttggctggattgagtcagataacaaatcag
ctccatactttcaatgatgtgtgcaataacgaatcattggtatcagacacagaaacgtcc
attgcaaaagaacttgcagactggcttattagcaacaatgtagtagaacatatatttgga
ccaaatttacatattgagattattaaacagtgccaagtgattttgaatttcttggcagca
gagggacgactgagtactcagcatattgactgcatttgggctgcagcacagctgaagcac
tgtagtcgatatattcatgacttattcccttcactcatcaagaatctggatcctgtgcca
cttagacatttacttaatctggtctcagctcttgaaccaggtgttcatactgaacagaca
ctgtacttggcatccatgttaattaaagctttgtggaataatgcacttgcagctaaggct
cagctgtctaaacagagttcttttgcatctttattaaacactaatatgcccattggaaac
aagaaagaggaagaagagcttagaagagcagctccttcaccttggtccccagcagcgagt
cctcaaagtagtgataacagtgacacacatcagagtggagccagtgacattgaaatggat
gagcagcttattaatagaaataaacatgtgcagcagcgactgtctgacactgaggaatcc
atgcaaggaagttctgatgaaactgccaacagtggtgaagatggaagcagtggccctggt
agcagtagtgggcatagtgatggatctagcaatgaagttaattcaagccatgcaagccag
tctgctgggagccctggaagtgaggtgcaatcagaagacattgcagacatcgaggccctt
aaagaagaagaggaagaggaggaggaagaagaagaagaggaagaggaagaagatgatgaa
gaagaagaagatgaagaagaagatgatgatgacgacgatgatcatggtcacaatcctgcc
aaaaatacttgtggtacagaacttcgaaacagaaagttagaaaatccagcaggcatttgc
ttgggggaatcccaaggcacatctgaaaggaatgggacaaatagtggaactggaaaggac
ctggtttttaatactgagccattgccatctgtagataaccgaatacgaatgctagatgcc
tgtgctcactctgaagacccagaacatggcatttcaggggaagtgagttctgctcactta
gcacaaggttctcaggaggcttgtatcacacgaagtggggacttccttggggagactatt
gggaatgagttgtttaattgtcggcagtttattggtccacagcatcaccaccaccaccac
caccaccaccaccatcatcaccatcaccaccaccaccaccaccaccaccacgatggacat
atggttgatgatatgctaagtgcagatgatgtcagttgcagtagctcccaggtcagtgca
aaatcagaaaaaaatatggctgattttgatggtgaagaatctggatgtgaagaggaacta
gttcagataaattcacatgcagaactaacatctcatctccaacaacatcttcccaattta
gcatctatttatcatgaacatcttagtcaaggacctgcagttcataaacatcaattcagt
agtaatgctgtgacagatattaatttggataatgtttgcaagaaaggaaatactttatta
tgggatatagtgcaagatgatgatgcaattaatctttctgaaggattaataaatgaagca
gagaaacttctctgttctttggtttgttggtttacggatagacaaattcgaatgagattc
attgaaggctgccttgaaaatttagggaacaacagatcagtggtgatttcacttcgtctt
cttccaaaactgtttggtacttttcagcagtttggaagcagttatgatactcattggatt
acaatgtgggcagagaaagaactgaacatgatgaagcttttctttgacaatctggtgtat
tacattcaaggtataagggaaggcagacaaaagcatgcactgtacagccatagtgccgaa
gttcaagttcgacttcagttcctgacctgtgtgttttcaaccctgggatcccctgatcac
ttcaggttaagtttagagcaagtggacattttatggcattgtttggtagaagactctgag
tgctatgatgatgcacttcattggtttttaaatcaagttcgaagtaaagatcaacatgca
atgggaatggaaacctataaacatcttttcctggagaagatgccccagcttaaacctgaa
acaattagcatgactggcttaaacctgtttcagcatctttgtaacttggctcgattggct
accagtgcctatgatggtggctcaaactctgagctgtgtggtatggaccaattttggggt
attgcattaagagcacaatcaggtgatgtcagtagagctgctattcagtatattaactcc
tactatattaatggtaaaacgggtttggaaaaggagcaagaatttattagtaagtgcatg
gaaagtctcatgatagcttctagcagtcttgaacaagaatcacactcaagtctcacagtt
atagaacgaggattgcttatgctgaagacacatctggaagcatttaggagaaggtttgca
tatcatctgagacagtggcagattgagggcaccggtattagcagtcacttgaaagcactg
agtgacaaacagtctttgcctctaagggttgtatgtcagcctgctggacttcccgacaag
atgactattgaaatgtatccaagtgaccaggtagcagatcttcgtgctgaagtaactcac
tggtatgaaaacttacagaaagaacaaataaatcaacaagctcagcttcaggagtttggt
caaagcagcagaaagggagagtttcctggtggcctcatggggcctgtcaggatgatctcc
tctggacatgaattaacaacagactatgatgaaaaagcacttcatgaacttggttttaaa
gatatgcagatggtgtttgtatctttgggtgcaccaagaagagaaagaaaaggagaaggg
gttcaactgcctgcatcttgcctcccaccacctcagaaggacaacattccgatgcttttg
ctgttacaagaacctcatttaactactctctttgatttattagaaatgcttgcttcattt
aaaccaccctcaggaaaagttgcagttgatgacagtgagagtttaaaatgtgaagaactt
catcttcatgcagaaaatctttcaaggcgtgtctgggagttgctgatgcttcttccgact
tgtcccaacatgctgacggcattccagaatgtctcagacgagcagagcaatgatggactt
aattggaaggaacttctcaaaattaagagtgctcataagttgttatatgctcttgagatt
attgaagcactaggaaaacctaacagaagaataagaagagagtcaacgggaagttacagt
gatctttatccagattctgatgattcaagtgaagatcaagtggaaaacagtaaaaattcc
tggacttgcaagtttgttgctgctggcgggcttcagcagttactagaaatttttaattct
gcgattctagagcctaaagagcaagaatcatggactgtgtggcagctggattgtcttgct
tgcttgctgaaattaatctgccagtttgcagtagatccgtcagatttggatttagcttat
catgatgtttttgcctggtctggcatagccgaaagccataggaaaagaacctggcctgga
aaatcaagaaaggctgctggtgatcatgccaagagtcttcatataccacgattaacagag
gtgtttcttgtgcttgtccaaggaaccagtttgattcagcgacttatgtctgttgcttat
acgtatgataatctggctcctagagttttgaaagctcagtctgatcataggtctagacat
gaagtgtcccattattcaatgtggctcttggtgagctgggctcattgctgctctttagtc
aagtctagtcttgccgacagtgatcatttacaagattggctaaaacagctgactctcctt
attcccgagactgcagttcgccatgaatcttgcaatggtctctataagctatctctgtca
ggcctagatggaggagactcaatccatcgatccttccttcttttggctgcctcaacatta
ttgaaattccttcctgatgctcaagcactcaaacctccaaggatagatgattatgaagaa
gaaccactgttaaaacctggatgtaaagaatatttttggttattatgcaagttagtggac
aacatacacataaaggacgctagtcagacaacactccttgatttagatgctttggcaaga
catttggctgactgtattcgcagtagagaaatcctggaccacctagatggcagtatagaa
gatgatgggctttcggggctcctgagactggcaacaagtgttattaaacacaagccaccc
ttcaaattctcaagagagggacaggaatttttaagagatatcttcaatcttctgtttttg
ttgcccagtctaaaggaccgacggcagccaaagtgcaaatcacactcttgcagggctgct
gcttatgatttgttggtggagatggtgaaagggtctgtagagaactacaggctcatacac
aactgggttatggcacagcacatgcagtcccatgcaccttacaagtgggactactggcct
catgaggatgtccgtgcagaatgccggtttgttggccttactaaccttggagctacttgt
tacttggcctctactattcagcagctgtacatgataccagaggcaagacaggctgtcttc
actgctaagtattcagaagacatgaagcacaagacaactcttctggaacttcagaaaatg
tttacatatttaatggagagtgagtgcaaagcctataaccctaggcctttctgtaaaact
tacactatggacaagcagcctctcaacactggggagcagaaagacatgacagagttcttt
acagatctcattactaaagtggaagaaatgtcgccagaactgaaaaatactgtcaaaagc
ctgtttggaggtgtcattacaaacaatgttgtttcgttggattgtgaacatgttagtcaa
actgctgaagaattttatactgtgaggtgccaggtggcagatatgaagaatatttatgag
tctctggatgaagttactattaaagacaccttagaaggggacaacatgtacacctgttct
cactgtgggaagaaagtccgagctgaaaagagggcttgttttaagaaattacctcgtatt
ctgagtttcaatactatgagatatacatttaatatggtcacgatgatgaaagagaaagtg
aatacacacttttctttccctttacgtttggatatgacgccctatacagaagattttcta
atggggaagagcgacaggaaagaaggtttcaaagatgttggtgatcgttcgaaagacaca
gagagctatgagtatgacttgattggagtgactgttcacacaggaacagcagacggtggg
cactattacagtttcatcagagacatagtcaatccacatgcctataagaacaataagtgg
tacctttttaatgatgctgaggtgaagccctttgattctgctcaacttgcttctgaatgc
tttggtggtgagatgaccacaaaaacctatgattcggttacagataaattcatggacttt
tcctttgaaaagacacatagtgcatatatgctgttttacaaacgcatggaaccagaagaa
gaaaatggcagagaatacaaatttgatgtttcatcagagttactagagtggatttggcat
gataacatgcaatttttacaagacaaaaacatttttgaacacacttattttgggtttatg
tggcagctgtgcagttgtattccaagtacattaccagatcctaaagctgtgtccctcatg
acagcaaagttaagtacttcctttgttttagagacattcattcattcaaaagagaagcca
acaatgcttcagtggattgaactactgaccaaacaatttaataatagtcaagcagcctgt
gagtggtttttagaccgcatggctgatgatgactggtggccaatgcagatactaattaag
tgtcccaatcagattgtgagacagatgttccagcgtttatgtatccatgtgattcagaga
ctgagacctgtgcacgctcatctctatctacaaccaggaatggaagatgggtcagatgat
atggatgcctcagtagaagatattggtggtcgttcatgtgtgactcgatttgttagaaca
ctgttgttaattatggaacacggtgtaaaacctcacagcaaacatcttactgagtatttt
gctttcctttacgaatttgccaaaatgggtgaagaagagagccagtttctgctttcattg
caagccatatctacaatggtacatttctatatgggaaccaaaggacctgaaaatcctcaa
gttgaagtattgtcagaggaagaaggggaagaagaggaggaagaagaagacatcctctct
ctggcagaagaaaaatacagacctgctgcccttgaaaagatgatagctttagttgctctt
ttggttgaacagtctcgctcagaaaggcatttgacattgtcacagactgacatggctgca
ttaacaggaggaaagggatttcccttcttatttcaacacattcgtgatggcatcaatata
agacaaacttgtaatctaatttttagcctgtgtcggtacaacaatcgacttgcagaacat
attgtatctatgcttttcacttcaatagcaaagttgacacctgaggcagccaatcctttc
tttaaattgttgaccatgttaatggaatttgctggtgggcctccaggaatgcctcccttt
gcatcttacattctgcagaggatatgggaggttattgaatacaatccttctcagtgtctg
gactggttggcagtgcagacaccccgaaataagctggcacacagctgggtcctccagaat
atggaaaattgggtggagcggtttcttttggctcacaattatcctagagtcaggacttct
gcagcttatcttctggtgtcccttataccaagcaattcattccgccagatgttccggtca
acaaggtctttgcacatcccaacccgtgaccttccactcagtccagacacaacagtagtc
ctacatcaggtctacaacgtgctccttggtttgctctcaagagccaaactttatgttgat
gctgctgttcatggcactacaaagctagtgccctatctgagctttatgacttactgttta
atttccaaaactgagaagctgatgttttccacatatttcatggatttgtggaaccttttc
cagcctaaactttctgagccagcaatagctacaaatcacaataaacaggctttgctttca
ttttggtacaatgtgtgtgctgactgtccagagaatatccgccttattgttcagaaccca
gtggtaaccaagaacattgccttcaattacatccttgctgaccatgatgatcaggatgtg
gtgctttttaaccgcgggatgctgcctgcctactatggcattctgaggctctgctgtgag
caatcacctgcatttactcgacagctagcttctcatcagaacatccagtgggcctttaag
aatcttacaccacatgccagccagtaccctggagctgtggaagaactgtttaacttgatg
cagctatttatagctcaaaggccagacatgcgagaagaagaattagaagatattaaacag
tttaagaaaacaaccataagctgttacttacgttgcttagatggccgctcttgttggact
actttaataagtgccttcagaatactattagaatctgatgaagatagacttctcgtagta
tttaatcgagggttaatcctgatgactgagtctttcaacacattgcacatgatgtatcat
gaagctacagcttgccatgttactggagacttagtagagctgctgtcaatattcctttcg
gttttgaagtctacacgcccatatcttcagagaaaagatgtgaaacaggcattaatccag
tggcaggagagaattgaatttgcccataaacttctaacccttcttaattcttatagccct
ccagaattaagaaatgcttgcatagatgtcctcaaggaactcgttcttttgagtccccat
gattttctgcatactctggttcccttcctacaacacaaccattgtacttaccatcacagt
aatataccaatgtctcttggaccttatttcccttgtcgagaaaatatcaagctaatagga
gggaaaagcaatattcggcctccgcgccctgaactcaatatgtgcctcttgcccacaatg
gtggaaaccagtaagggcaaagatgacgtttatgatcgtatgctgctagactacttcttt
tcttatcatcagttcatccatctattatgccgagttgcaatcaactgtgaaaaatttact
gaaacattagttaagctgagtgtcctggttgcctatgaaggcttgccacttcatcttgca
ctgttccccaaactttggactgagctatgccagactcagtcagctatgtcgaaaaactgc
atcaagcttctgtgtgaagaccctgtttttgcagagtacattaaatgtatcctaatggac
gaaagaacttttctaaataacaatattgtctacacattcatgacacatttccttctaaag
gttcaaagtcaagtgttctcagaagcaaactgtgccagtttgatcagtacccttatcaca
aacctgataaatcagtatcaaaacctacaatctgatttcaccaaccgagttgaaatttca
aaagcaagtgctgctttaaatggggacctgagggcacttgctttgctcctgtcagtacac
actcccaaacagttaaacccagctctgatcccaactctgcaagagcttttaaacaagtgt
aggacttgtctgcagcagagaaactcactccaagagcaagaagccaaagaaagaaaaact
aaagatgacgaaggagcaactcctgttaaaagacggcgagtgagcagtgatgaggagcac
actgtagacagttgcattggtgacataaaaacagagaccagggaggtcctgacccccact
agcacctcagacaatgagacaagagactcatcgattattgacccagggacagagcaagat
cttccgtctcctgaaaacagctctgtcaaagagtatcgaatggaaggcccatcttcattt
tcagaagatggttcacatatccggtcacagcatgcagaggaacagtctaacaatggcagg
tttgacgactgtaaagagtttaaagaccactgttccaaggatactacactagctgaagat
gaatccgaattcccttcaacgtccatctccgcagttctgtctgacttagctgatctgaga
agctgtgatggtcaagctttgtcctcccaggaccctgaagctgctgtgtccctcagttgt
ggccattccagaggcctcattagtcatatgcagcaacacgacattttagataccctgtgt
aggaccattgaatcaacaatccatgtggtcacaaggatatctggcaaaggaaaccaagct
gcttcttga

DBGET integrated database retrieval system