KEGG   Mus musculus (mouse): 17855Help
Entry
17855             CDS       T01002                                 

Gene name
Mvk, 2310010A05Rik, AI256848, AI414037, MK
Definition
(RefSeq) mevalonate kinase (EC:2.7.1.36)
  KO
K00869  
mevalonate kinase [EC:2.7.1.36]
Organism
mmu  Mus musculus (mouse)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    17855 (Mvk)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    17855 (Mvk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     17855 (Mvk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 F; 5 55.99 cM
AA seq 395 aa AA seqDB search
MLSEALLVSAPGKVILHGEHAVVHGKVALAAALNLRTFLLLRPQSNGKVSVNLPNIGIKQ
VWDVGMLQRLDTSFLEQGDVSVPTLEQLEKLKKMGDLPRDRAGNEGMALLAFLYLYLAIC
RKQRTLPSLDMVVWSELPPGAGLGSSAAYSVCLAAALLTACEEVSNPLKDGVSVSRWPEE
DLKSINKWAFEGERVIHGNPSGVDNAVSTWGGALRFQQGTMSSLKSLPSLQILLTNTKVP
RSTKALVAAVRSRLTKFPEIVAPLLTSIDAISLECERVLGEMVAAPVPEQYLVLEELIDM
NQHHLNALGVGHNSLDQLCQVTAAHGLHSKLTGAGGGGCGITLLKPGLEQATVEAAKQAL
TSCGFDCWETSIGAPGVSTHSAAAVGDPVRQALGL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcagaagccctgctggtgtccgccccggggaaggtcatcctccatggagaacac
gctgtggtccatggcaaggtcgctctggcagcggccttgaacttgagaactttcctcctg
ctgcgaccgcagagcaatgggaaagtgagcgtcaatttacccaacatcggtattaagcag
gtgtgggatgtgggcatgcttcagcgactggacacgagctttcttgagcaaggtgatgtc
tcggtacccaccttggagcaactggagaagctaaagaagatgggggacctccccagagac
cgtgcaggcaatgaaggcatggctctgcttgcctttctctacctgtacctggcaatctgc
cggaagcagaggacactcccgagcctggacatggtggtgtggtcggaacttccccccggg
gcaggcttgggctccagcgccgcctactctgtgtgtctggcagccgccctcctgactgcc
tgtgaggaggtctccaacccgctcaaggacggggtctccgtcagcaggtggcccgaggaa
gatctgaagtcaatcaacaagtgggccttcgaaggggagagagtgatccatgggaaccct
tctggtgtggacaatgccgtcagcacctggggcggagccctgcgcttccagcaagggacg
atgtcttccttgaagagcctcccgtctctgcagatcctgctcaccaacaccaaggtcccg
cggagtaccaaggcccttgtggctgctgtcagaagcaggctgaccaagttccctgagatt
gtggccccgctgctgacctccattgacgcaatatccctggagtgtgagcgcgtgctaggg
gagatggtggcagctccagttccggaacagtacctcgtactagaagagctgatagacatg
aaccagcaccatctgaatgctctcggggtgggccacaactccctggaccagctctgccaa
gtaacggcagcacacggactgcacagcaagctgacgggcgctggcggtggcggctgtggc
atcaccctcctgaagccaggtctagagcaagccacagtggaggcagccaagcaggccctg
accagctgcgggtttgactgctgggagaccagcatcggcgcacccggagtttccacacac
tcagctgcagctgtaggggaccctgtccgacaagccctgggcctctga

DBGET integrated database retrieval system