KEGG   Mus musculus (mouse): 17863Help
Entry
17863             CDS       T01002                                 

Gene name
Myb, AI550390, M16449, c-myb
Definition
myeloblastosis oncogene
Orthology
K09420  
myb proto-oncogene protein
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    17863 (Myb)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    17863 (Myb)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    17863 (Myb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 A3; 10 9.75 cM
AA seq 755 aa AA seqDB search
MARRPRHSIYSSDEDDEDIEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQEPSKASQTPVATSFQKNNHLMGFGHASPPSQLSPSGQSSV
NSEYPYYHIAEAQNISSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQALPTQNHTCSYPGWHSTSIVDQTRPHGDSAPVSCLGEHHATPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSWCDLSSFEFSEEAAAF
SPSQQPTGKAFQLQQREGHGTRSAGEPSLRVTRRVLSEASLGPDSPQARHSKVPLVVLRK
RRGQASPLAAGEPSPSLFADVISSTLKRSPVKSLPFSPSQFLNTSSNHESSGLDAPTLPS
TPLIGHKLTPCRDQTVKTQKENSIFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHAVEDLQDVIKQESDESGIVAEFQESGPPLLKKIKQEVESPTEKSGNFFCSNH
WAENSLSTQLFSQASPVADAPNILTSSVLMTPVSEDEDNVLKAFTVPKNRPLVGPLQPCS
GAWEPASCGKTEDQMTASGPARKYVNAFSARTLVM
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggcccggagaccccgacacagcatctacagtagcgatgaagatgatgaagacattgag
atgtgtgaccatgactacgatgggctgctgcccaaatctggaaagcgtcacttggggaaa
actaggtggacaagggaagaggatgagaagctgaagaagctggtggaacagaacggaaca
gacgactggaaagtcattgccaattatctgcccaaccggacagatgtgcagtgccaacac
cggtggcagaaagtgctgaaccctgaactcatcaaaggtccctggaccaaagaagaagat
cagagagtcatagagcttgtccagaaatatggtccgaagcgttggtctgttattgccaag
cacttaaaagggagaattggaaagcagtgtcgggagaggtggcacaaccatttgaatcca
gaagttaagaaaacctcctggacagaagaggaggacagaatcatttaccaggcacacaag
cgtctggggaacagatgggcagagatcgcaaagctgctgcccggacggactgataatgct
atcaagaaccactggaattccaccatgcgtcgcaaggtggaacaggaaggctacctgcag
gagccttccaaagccagccagacgccagtggccacgagcttccagaagaacaatcatttg
atggggtttgggcatgcctcacctccatctcagctctctccaagtggccagtcctccgtc
aacagcgaatatccctattaccacatcgccgaagcacaaaacatctccagtcacgttccc
tatcctgtcgcattgcatgttaatatagtcaacgtccctcagccggctgcggcagccatc
cagagacactataacgacgaagaccctgagaaggaaaagcgaataaaggagctggagttg
ctcctgatgtcaacagagaacgagctgaagggacagcaggcattaccaacacagaaccac
acttgcagctaccccgggtggcacagcacctccattgtggaccagaccagacctcatggg
gatagtgcacctgtttcctgtttgggagaacaccatgccaccccatctctgcctgcagat
cccggctccctacctgaagaaagtgcctcaccagcaaggtgcatgatcgtccaccagggc
accattctggacaatgttaagaacctcttagaatttgcagaaacactccagtttatagat
tctgattcttcgtggtgtgatctcagcagttttgaattctctgaagaagcggcagctttt
tcacctagccagcagcccacaggcaaagccttccagcttcagcaaagagagggccatggg
actagatctgcaggagagcctagcctgagggtgaccaggcgagtgctgagcgaggcatcc
ctcggcccagactcaccccaagcgaggcacagcaaggttccgctggtcgtcctacgaaaa
aggcggggccaggccagccccctagccgctggagagcctagcccctccctctttgctgac
gtcatcagctcaactctcaagcgttcccctgtcaaaagcctacccttctctccctcgcag
ttcttgaacacttccagcaaccatgaaagctcgggcttagatgcacctaccttaccctcc
actcctctcattggtcacaaactgacaccatgtcgagaccagactgtgaaaacccagaag
gaaaattccatctttagaactccagctatcaaaaggtcaatcctcgaaagctctcctcga
actcccacaccattcaaacatgcccttgcagctcaagaaattaaatacggtcccctgaag
atgctacctcagaccccctcccatgcagtggaggacctacaagatgtgattaagcaggaa
tcggatgaatctggaattgtggctgagtttcaagagagtggaccaccgttactgaaaaaa
atcaagcaggaggtggagtcgccaactgagaaatcgggaaacttcttctgctcaaaccac
tgggcagagaacagcctgagcacccagctgttctcgcaggcgtctcctgtggcagatgcc
ccaaatattcttacaagctctgttttaatgacacctgtatcagaagatgaagacaatgtc
ctcaaagcctttaccgtacctaagaacaggcccctggtgggtcccttgcagccatgcagt
ggtgcctgggagccagcatcctgtgggaagacagaggaccagatgacggcctccggtccg
gctcggaaatacgtgaacgcgttctcagctcgaactctggtcatgtga

DBGET integrated database retrieval system