KEGG   Mus musculus (mouse): 17869Help
Entry
17869             CDS       T01002                                 

Gene name
Myc, AU016757, Myc2, Niard, Nird, bHLHe39
Definition
myelocytomatosis oncogene
Orthology
K04377  
Myc proto-oncogene protein
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Jak-STAT signaling pathway
Thyroid hormone signaling pathway
Hepatitis B
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Endometrial cancer
Thyroid cancer
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mmu04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:mmu04310]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:mmu04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:mmu04390]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mmu04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mmu04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mmu04919]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mmu05202]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:mmu05205]
Human Diseases; Cancers; Colorectal cancer [PATH:mmu05210]
Human Diseases; Cancers; Thyroid cancer [PATH:mmu05216]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:mmu05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mmu05220]
Human Diseases; Cancers; Bladder cancer [PATH:mmu05219]
Human Diseases; Cancers; Endometrial cancer [PATH:mmu05213]
Human Diseases; Cancers; Small cell lung cancer [PATH:mmu05222]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mmu05161]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mmu05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 D2-D3; 15 26.19 cM
AA seq 439 aa AA seqDB search
MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQ
DLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacgtgaacttcaccaacaggaactatgacctcgactacgactccgtacag
ccctatttcatctgcgacgaggaagagaatttctatcaccagcaacagcagagcgagctg
cagccgcccgcgcccagtgaggatatctggaagaaattcgagctgcttcccaccccgccc
ctgtccccgagccgccgctccgggctctgctctccatcctatgttgcggtcgctacgtcc
ttctccccaagggaagacgatgacggcggcggtggcaacttctccaccgccgatcagctg
gagatgatgaccgagttacttggaggagacatggtgaaccagagcttcatctgcgatcct
gacgacgagaccttcatcaagaacatcatcatccaggactgtatgtggagcggtttctca
gccgctgccaagctggtctcggagaagctggcctcctaccaggctgcgcgcaaagacagc
accagcctgagccccgcccgcgggcacagcgtctgctccacctccagcctgtacctgcag
gacctcaccgccgccgcgtccgagtgcattgacccctcagtggtctttccctacccgctc
aacgacagcagctcgcccaaatcctgtacctcgtccgattccacggccttctctccttcc
tcggactcgctgctgtcctccgagtcctccccacgggccagccctgagcccctagtgctg
catgaggagacaccgcccaccaccagcagcgactctgaagaagagcaagaagatgaggaa
gaaattgatgtggtgtctgtggagaagaggcaaacccctgccaagaggtcggagtcgggc
tcatctccatcccgaggccacagcaaacctccgcacagcccactggtcctcaagaggtgc
cacgtctccactcaccagcacaactacgccgcacccccctccacaaggaaggactatcca
gctgccaagagggccaagttggacagtggcagggtcctgaagcagatcagcaacaaccgc
aagtgctccagccccaggtcctcagacacggaggaaaacgacaagaggcggacacacaac
gtcttggaacgtcagaggaggaacgagctgaagcgcagcttttttgccctgcgtgaccag
atccctgaattggaaaacaacgaaaaggcccccaaggtagtgatcctcaaaaaagccacc
gcctacatcctgtccattcaagcagacgagcacaagctcacctctgaaaaggacttattg
aggaaacgacgagaacagttgaaacacaaactcgaacagcttcgaaactctggtgcataa

DBGET integrated database retrieval system