KEGG   Mus musculus (mouse): 17869Help
Entry
17869             CDS       T01002                                 

Gene name
Myc, AU016757, Myc2, Niard, Nird, bHLHe39
Definition
myelocytomatosis oncogene
Orthology
K04377  
Myc proto-oncogene protein
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Thyroid hormone signaling pathway
Hepatitis B
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Endometrial cancer
Thyroid cancer
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    17869 (Myc)
   04012 ErbB signaling pathway
    17869 (Myc)
   04310 Wnt signaling pathway
    17869 (Myc)
   04350 TGF-beta signaling pathway
    17869 (Myc)
   04390 Hippo signaling pathway
    17869 (Myc)
   04630 Jak-STAT signaling pathway
    17869 (Myc)
   04151 PI3K-Akt signaling pathway
    17869 (Myc)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    17869 (Myc)
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    17869 (Myc)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    17869 (Myc)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    17869 (Myc)
   05230 Central carbon metabolism in cancer
    17869 (Myc)
   05202 Transcriptional misregulation in cancers
    17869 (Myc)
   05206 MicroRNAs in cancer
    17869 (Myc)
   05205 Proteoglycans in cancer
    17869 (Myc)
   05210 Colorectal cancer
    17869 (Myc)
   05216 Thyroid cancer
    17869 (Myc)
   05221 Acute myeloid leukemia
    17869 (Myc)
   05220 Chronic myeloid leukemia
    17869 (Myc)
   05219 Bladder cancer
    17869 (Myc)
   05213 Endometrial cancer
    17869 (Myc)
   05222 Small cell lung cancer
    17869 (Myc)
  Infectious diseases
   05166 HTLV-I infection
    17869 (Myc)
   05161 Hepatitis B
    17869 (Myc)
   05169 Epstein-Barr virus infection
    17869 (Myc)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    17869 (Myc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 D2-D3; 15 26.19 cM
AA seq 439 aa AA seqDB search
MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQ
DLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacgtgaacttcaccaacaggaactatgacctcgactacgactccgtacag
ccctatttcatctgcgacgaggaagagaatttctatcaccagcaacagcagagcgagctg
cagccgcccgcgcccagtgaggatatctggaagaaattcgagctgcttcccaccccgccc
ctgtccccgagccgccgctccgggctctgctctccatcctatgttgcggtcgctacgtcc
ttctccccaagggaagacgatgacggcggcggtggcaacttctccaccgccgatcagctg
gagatgatgaccgagttacttggaggagacatggtgaaccagagcttcatctgcgatcct
gacgacgagaccttcatcaagaacatcatcatccaggactgtatgtggagcggtttctca
gccgctgccaagctggtctcggagaagctggcctcctaccaggctgcgcgcaaagacagc
accagcctgagccccgcccgcgggcacagcgtctgctccacctccagcctgtacctgcag
gacctcaccgccgccgcgtccgagtgcattgacccctcagtggtctttccctacccgctc
aacgacagcagctcgcccaaatcctgtacctcgtccgattccacggccttctctccttcc
tcggactcgctgctgtcctccgagtcctccccacgggccagccctgagcccctagtgctg
catgaggagacaccgcccaccaccagcagcgactctgaagaagagcaagaagatgaggaa
gaaattgatgtggtgtctgtggagaagaggcaaacccctgccaagaggtcggagtcgggc
tcatctccatcccgaggccacagcaaacctccgcacagcccactggtcctcaagaggtgc
cacgtctccactcaccagcacaactacgccgcacccccctccacaaggaaggactatcca
gctgccaagagggccaagttggacagtggcagggtcctgaagcagatcagcaacaaccgc
aagtgctccagccccaggtcctcagacacggaggaaaacgacaagaggcggacacacaac
gtcttggaacgtcagaggaggaacgagctgaagcgcagcttttttgccctgcgtgaccag
atccctgaattggaaaacaacgaaaaggcccccaaggtagtgatcctcaaaaaagccacc
gcctacatcctgtccattcaagcagacgagcacaagctcacctctgaaaaggacttattg
aggaaacgacgagaacagttgaaacacaaactcgaacagcttcgaaactctggtgcataa

DBGET integrated database retrieval system