KEGG   Mus musculus (mouse): 17898Help
Entry
17898             CDS       T01002                                 

Gene name
Myl7, MLC-2alpha, MLC2a, MYL2A, Mylc2a, RLC-A
Definition
(RefSeq) myosin, light polypeptide 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
mmu  Mus musculus (mouse)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    17898 (Myl7)
  Cellular community - eukaryotes
   04510 Focal adhesion
    17898 (Myl7)
   04530 Tight junction
    17898 (Myl7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    17898 (Myl7)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17898 (Myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A1; 11 3.88 cM
AA seq 175 aa AA seqDB search
MASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLKET
YSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQG
VVNKEEFKQLLMTQADKFSPAEVEQLFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaggaaggctgggacccgaggcaaggctgcagccaccaagcaggcacaacgt
ggctcttctaatgtcttctcaatgttcgaacaagcccagattcaggaattcaaggaagcc
ttcagctgcattgaccagaacagggatgggatcatctgcaaatcagacctgaaggagacc
tattcccagctcgggagggtaagtgttccggaggaagagctggacgccatgctgcaggaa
gggaagggtcccatcaacttcaccgtcttcctcacactcttcggggagaagctcaatggg
acggaccccgaggaagccatcctgagtgccttccgcatgttcgaccccagcggccagggg
gtggtgaacaaggaagagttcaagcagcttctcatgacccaggcagacaagttctctcct
gctgaggtagagcaactgtttgcgctgacacccatggacctggccggcaacattgactac
aagtctctctgctacatcatcacccacggggatgagaaagaggagtag

DBGET integrated database retrieval system