KEGG   Mus musculus (mouse): 17898Help
Entry
17898             CDS       T01002                                 

Gene name
Myl7, MLC-2alpha, MLC2a, MYL2A, Mylc2a, RLC-A
Definition
myosin, light polypeptide 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
mmu  Mus musculus (mouse)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    17898 (Myl7)
  Cellular commiunity
   04510 Focal adhesion
    17898 (Myl7)
   04530 Tight junction
    17898 (Myl7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    17898 (Myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A1; 11 3.88 cM
AA seq 175 aa AA seqDB search
MASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLKET
YSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQG
VVNKEEFKQLLMTQADKFSPAEVEQLFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaggaaggctgggacccgaggcaaggctgcagccaccaagcaggcacaacgt
ggctcttctaatgtcttctcaatgttcgaacaagcccagattcaggaattcaaggaagcc
ttcagctgcattgaccagaacagggatgggatcatctgcaaatcagacctgaaggagacc
tattcccagctcgggagggtaagtgttccggaggaagagctggacgccatgctgcaggaa
gggaagggtcccatcaacttcaccgtcttcctcacactcttcggggagaagctcaatggg
acggaccccgaggaagccatcctgagtgccttccgcatgttcgaccccagcggccagggg
gtggtgaacaaggaagagttcaagcagcttctcatgacccaggcagacaagttctctcct
gctgaggtagagcaactgtttgcgctgacacccatggacctggccggcaacattgactac
aagtctctctgctacatcatcacccacggggatgagaaagaggagtag

DBGET integrated database retrieval system