KEGG   Mus musculus (mouse): 17901Help
Entry
17901             CDS       T01002                                 

Gene name
Myl1, AI325107, MLC1f, MLC3f, Mylf
Definition
(RefSeq) myosin, light polypeptide 1
  KO
K05738  
myosin light chain 1
Organism
mmu  Mus musculus (mouse)
Brite
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17901 (Myl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C3; 1 33.71 cM
AA seq 188 aa AA seqDB search
MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEDFKEAFLLFDRTG
ECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQ
GGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEA
FVKHIMSV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaagaaagacgtgaagaagcccgctgctgcgcctgccccagccccggccccg
gcccctgccccagccaaacctaaggaagaaaaaatcgatctgtctgctattaagatcgag
ttctctaaggagcaacaggaggacttcaaggaggcatttctcctgtttgacagaacaggt
gaatgcaagatcaccttaagtcaggtgggagacgtcctccgggctctgggcaccaatccc
accaatgcagaggtcaagaaggttcttgggaaccccagcaatgaagagatgaatgctaag
aaaatcgagtttgaacagtttctgcccatgatgcaagctatctccaacaacaaggaccag
ggaggttatgaagatttcgttgagggtctgcgtgtcttcgacaaggagggcaatggcacc
gtcatgggtgctgaactccgccatgtcctcgccactctgggagagaagatgaaggaggaa
gaggtagaagcgttgctggcaggccaggaggactccaatggctgcatcaactatgaagct
tttgtcaaacacatcatgtctgtctaa

DBGET integrated database retrieval system