KEGG   Mus musculus (mouse): 17918Help
Entry
17918             CDS       T01002                                 

Gene name
Myo5a, 9630007J19Rik, AI413174, AI661011, Dbv, MVa, Myo5, MyoVA, Sev-1, d, d-120J, flail, flr
Definition
(RefSeq) myosin VA
  KO
K10357  
myosin V
Organism
mmu  Mus musculus (mouse)
Brite
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     17918 (Myo5a)
   mRNA cycle factors
    P-body specific factors
     17918 (Myo5a)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    17918 (Myo5a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17918 (Myo5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 D; 9 42.26 cM
AA seq 1853 aa AA seqDB search
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTGELP
HLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADSFHYTKQGGSPMIEGVD
DAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLTIF
CDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDHVN
QALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEK
PRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAIS
PTSATSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRC
IKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVL
GDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGW
LLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATTIQKYWRMYVVRRRYKIRRAA
TIVIQSYLRGYLTRNRYRKILREYKAVIIQKRVRGWLARTHYKRTMKAIVYLQCCFRRMM
AKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLMEKLTNLEGVYNSE
TEKLRNDVERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKSIEERADKYKQET
DQLVSNLKEENTLLKQEKETLNHRIVEQAKEMTETMERKLVEETKQLELDLNDERLRYQN
LLNEFSRLEERYDDLKEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDIAPRT
EEPIEKKVPLDMSLFLKLQKRVTELEQEKQLMQDELDRKEEQVFRSKAKEEERPQIRGAE
LEYESLKRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELD
VRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMKDKGEIAQAYIGLKETNR
LLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITR
LTNENLYFEELYADDPKKYQSYRISLYKRMIDLMEQLEKQDKTVRKLKKQLKVFAKKIGE
LEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKREDEQKLVKNLILELKPRGVAV
NLIPGLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTC
RFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQ
PMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDP
ELIKQVVKQMFYIVGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKE
TLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIR
TIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIARV
NT seq 5562 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtccgagctctacaccaagtttgccagggtttggatccctgatcctgaggaa
gtgtggaaatcggcagagttgctcaaggattataagcctggagataaagtgctcctgctt
cacctcgaggaagggaaggatttggaataccgtctagacccaaagaccggtgagctccct
cacttacggaaccctgacatacttgttggagaaaatgacctcacagccctcagctacctt
cacgagcccgctgtgctacataatctccgagttcgcttcatcgattccaaacttatttat
acgtattgtggaatagttctggtagctataaatccctatgagcagctgcctatttatgga
gaagatattattaatgcctacagtggccagaacatgggtgacatggatcctcacatcttc
gcagtagctgaagaggcttacaagcaaatggcaagggatgaacgaaatcagtccatcatt
gtaagtggagagtcaggcgcagggaagacggtctctgctaagtatgccatgcggtacttc
gcaactgtaagtggctctgccagtgaggccaatgttgaggaaaaggtcttggcctccaac
cccatcatggagtcaattggaaatgccaaaacaaccaggaatgataatagcagccggttt
ggaaaatatattgaaattggttttgacaagaggtacagaatcatcggtgccaatatgaga
acttaccttttagagaaatccagagtggtgttccaggcagaagaggagagaaactaccat
atcttctatcagctctgtgcttcggcaaagttacctgagtttaaaatgctgcggttagga
aatgcagatagttttcattacacgaagcaaggaggcagccctatgatagaaggagtagat
gatgcgaaggagatggcgcacaccaggcaggcctgcactctgctgggaattagtgaatct
taccaaatgggaatttttcgaatacttgctggcattcttcacttaggcaatgttggattt
gcatctcgggattcagacagctgcacaatacctcccaagcacgaacctcttaccatcttc
tgtgaccttatgggtgtggattatgaagagatgtgtcactggctctgccaccgaaagctg
gctactgccacagagacatacatcaagcccatctccaagctgcaggccacaaatgcccga
gatgctttagcaaagcacatctatgcaaagctctttaactggattgttgaccacgtcaat
caggctctccattctgctgtcaagcagcactctttcatcggcgtgctggacatctatgga
tttgaaacatttgaaataaatagttttgaacagttctgcataaattatgcaaatgaaaaa
ctacaacaacaattcaacatgcatgtcttcaaattggaacaggaggaatatatgaaggaa
cagattccatggacacttatagatttctatgataatcagccttgtatcaatcttatagaa
tctaaactgggaattctcgatttgctggatgaggaatgtaagatgcctaaaggcacagat
gacacatgggcccaaaaactgtacaacacacatttgaacaaatgtgccctctttgagaag
ccccgcatgtcaaacaaagctttcatcatcaaacattttgctgacaaagtggagtaccag
tgtgaaggttttcttgaaaagaataaagatactgtttttgaagaacaaattaaagtcctt
aagtcaagcaagtttaagatgctaccagagctatttcaagatgatgagaaggccatcagt
cccacctctgccacctcctcagggcgcactcctctcactcgagttcctgtaaagcccacc
aagggccgacctggccagactgccaaagagcacaagaagacagtgggacatcagtttcga
aactcccttcacctgcttatggaaacccttaatgccactactcctcactatgtacgctgt
attaagcctaatgatttcaagtttccattcacatttgatgagaagagggcagtgcagcag
ctaagagcatgtggtgtcctggagaccatccggatcagcgcagcagggtttccctcacgg
tggacttaccaagagtttttcagccggtaccgggtcctaatgaagcaaaaagatgtgctg
ggagatagaaagcaaacgtgcaagaatgtattagagaaactaatattggacaaggataaa
taccagtttggtaagacaaagatctttttccgtgctggtcaagtggcctatcttgaaaaa
ttgagggctgacaaacttcgggctgcctgcatccggatccagaagaccattcgtgggtgg
cttctaaggaagagatacctgtgtatgcagagggcagccatcacagtgcagcgatacgtg
cggggctatcaggctcgatgctatgctaagtttctgcgcagaaccaaggcagcaaccacc
attcaaaagtactggcgcatgtatgtggtccgcaggaggtacaagattagacgagctgcc
acgattgttattcagtcttacttgagaggctacttgacaagaaataggtatcgcaagata
ctccgtgaatacaaagcagtcatcattcagaaacgtgtccgtggctggctggcccgtaca
cattataagaggaccatgaaagccatcgtctaccttcagtgctgcttccggcggatgatg
gccaagcgtgagctgaagaaactcaaaattgaggctcgctctgtggaacgctacaagaag
ctccatattggcatggagaacaagattatgcagctgcagcgcaaagtggatgagcagaat
aaagactacaaatgcctcatggagaaactgaccaatctggaaggagtatacaactctgag
actgaaaaactacgaaatgatgtagaacgtcttcagctaagtgaagaggaagctaaggtt
gccactgggcgggtccttagtctgcaggaagaaattgcaaaactccgaaaagacctggaa
caaactcgatcagagaaaaagtctattgaagaaagagcagataaatacaaacaagaaact
gaccagctggtgtcaaacttgaaggaagaaaatactttgctgaagcaggaaaaggagacc
ctcaaccaccgcattgtggagcaggcgaaggagatgacagaaactatggagaggaagtta
gtagaagagacaaaacaactggagcttgacctgaatgatgagaggctgaggtatcagaac
cttctgaatgagttcagtcgcctggaggagcgctatgatgacctcaaggaagagatgacc
ctgatgctgaatgtgcctaagccaggacacaagagaacagactctacccacagcagtaat
gagtctgaatacaccttcagctctgagtttgcagaaactgaagacattgcaccaagaaca
gaggagccaattgagaagaaggtgcctctggatatgtcactattccttaagctccagaag
cgtgtcacagagctggaacaggagaagcagctgatgcaggatgagctggaccgcaaggag
gagcaggtgttccgcagcaaggcaaaggaagaagaaaggccacagataagaggagctgaa
ctagagtatgagtctctcaagcgtcaagaactggagtcagaaaacaaaaaactgaaaaac
gagctgaatgagttgcgcaaagccctcagtgagaaaagtgccccagaagtgactgcgcca
ggtgcgcctgcttaccgagtcctcatggaacagctgacctccgtgagcgaggagctcgac
gtgcgcaaggaggaagtcctcatcttgaggtcgcagctggtgagccaaaaagaagccatc
caacccaaggatgacaagaatacaatgacagattccacaattcttttagaagatgtacag
aaaatgaaagacaaaggtgaaatagcacaagcatatattggtttgaaagaaacaaacagg
ctcttagaatcccagctacagtcacagaaaagaagccatgagaatgaggctgaggccctc
cgtggggagatccagagcctaaaggaagaaaacaaccggcaacagcagctgctggcccag
aacctgcagctgccccctgaggcccgcattgaggccagcctgcagcatgagatcacccgg
ctgaccaatgaaaacctgtattttgaggaattatatgcagatgaccctaagaagtatcaa
tcctatcggatttcactttacaaaaggatgattgatctgatggaacaacttgaaaagcag
gataaaactgtccggaaactgaagaaacaactgaaagtctttgccaaaaaaattggtgaa
ctagaagtggggcagatggagaacatatctccaggacagatcatcgatgagcctatccgg
ccagtcaacattccccggaaagaaaaggatttccaaggaatgctggagtacaaaagggag
gatgagcagaagctagtgaagaacctgattctagaactaaagccacgtggtgtggctgtc
aatctgattccagggttaccagcatatatcttgtttatgtgtgtacgacatgctgactat
ctgaacgatgatcagaaagtaagatcattgctgacatcaacaattaacagcatcaaaaaa
gtcttgaagaaaagaggtgacgattttgaaactgtctccttctggctctctaacacatgt
cgatttttgcactgtttgaagcaatatagtggagaggagggctttatgaagcacaacacg
tctcgccagaatgagcactgcctcaccaattttgaccttgctgaatatcggcaagtactg
agtgacttggccattcagatctatcagcagcttgtgagggtgttagagaacattcttcag
ccaatgatagtctcaggtatgctagagcatgaaacaattcagggcgtatctggggtgaag
cccacagggctcagaaaacgaacctccagtatcgcagatgagggcacctacacactggac
tccatccttcggcagctcaactccttccactcagtcatgtgtcagcatggcatggacccg
gagctaatcaagcaggtagtcaaacagatgttctacattgtgggcgccatcaccctaaac
aacctcctcctgcgcaaggacatgtgctcctggagcaagggcatgcagatcaggtacaat
gtcagtcaactggaagaatggctacgtgacaagaatctaatgaacagtggggccaaggag
actctggaacctcttatccaggccgctcagcttttgcaagtgaaaaagaaaactgacgat
gacgcagaagccatctgttccatgtgcaacgccctgaccacggcccagattgtcaaagtg
ttgaatctgtacacaccggttaatgagtttgaagaaagggtctcagtttcatttatccgc
actatacagatgcggttacgagacaggaaagactctccacagctgctcatggatgcaaaa
cacatctttcctgtcacttttccctttaacccatcctccctagccctagaaaccatccag
atcccagccagcctgggcctgggcttcatcgcacgggtctga

DBGET integrated database retrieval system