KEGG   Mus musculus (mouse): 17975Help
Entry
17975             CDS       T01002                                 

Gene name
Ncl, B530004O11Rik, C23, D0Nds28, D1Nds28, Nucl
Definition
(RefSeq) nucleolin
  KO
K11294  
nucleolin
Organism
mmu  Mus musculus (mouse)
Brite
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    17975 (Ncl)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     17975 (Ncl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 D; 1 43.94 cM
AA seq 707 aa AA seqDB search
MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTP
AKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIPTPGKKGAAQAKALVP
TPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPA
KAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTAKGKKTPAKVVPMKAKSVA
EEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKV
EGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAE
DLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAME
IRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTS
TWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEA
LNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTD
RETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGF
GGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctcgcaaaggctggcaaaacccacggtgaggccaagaaaatggctcctcct
ccaaaggaggtggaagaggatagtgaagatgaagaaatgtcagaagatgaagatgacagc
agtggagaagaggaggttgtcatccctcagaaaaaaggcaaaaaggctaccacaacccca
gcaaagaaggtggttgtttcacaaacaaaaaaggctgcagttcccacaccagctaagaaa
gcagctgtgaccccaggcaaaaaggcagtagccacaccagctaagaaaaacattacacca
gccaaagtcattccaacaccgggtaagaagggagctgcacaagcaaaagcgttggtacca
actcctggtaaaaagggagctgccactccagctaagggggctaagaacggtaagaatgcc
aagaaggaagacagtgatgaggatgaagatgaagaggatgaagatgatagcgatgaggat
gaagatgatgaggaagaggatgagtttgagccaccaatagtaaaaggagtgaagccagca
aaagcagctcctgctgctcctgcctcagaggatgaggaagatgatgaggatgaagatgat
gaggaagatgatgatgaagaggaggaagatgactctgaggaagaagttatggagatcaca
acagccaaaggaaagaaaactcctgcaaaagttgttcctatgaaagccaagagtgtggct
gaggaggaggatgatgaggaagaggatgaagatgacgaggatgaggatgatgaggaagag
gatgacgaagatgatgatgaggaagaagaggaggaagaacctgttaaagcagcacctgga
aaacggaagaaggagatgaccaagcagaaagaagcccctgaagccaagaaacagaaagta
gaaggctcagaaccaactacacctttcaatctgttcattggaaaccttaatccaaacaag
tctgttaatgaattaaaatttgccatcagtgaactttttgctaaaaatgatcttgctgtt
gtggatgtcagaactggtacaaataggaaatttggttatgtggactttgagtctgctgaa
gacctagaaaaggccttggagctcactggtttaaaagtgtttggcaatgaaattaaacta
gaaaaaccaaaaggaagagatagtaagaaagttcgagctgcaagaacacttctagccaaa
aacctctctttcaacatcactgaggatgaattaaaggaagtgtttgaagacgccatggag
atcagattagtcagccaggatgggaaaagtaaagggattgcttatattgaatttaagtct
gaagctgatgcagagaaaaatttggaagaaaagcagggggcagaaattgatggacgatct
gtttcactctactatactggagagaaaggtcaaaggcaagagagaactggaaagaccagc
acttggagtggtgaatcaaagactttggttttaagtaacctttcctacagtgcaacaaaa
gaaactcttgaggaagtatttgagaaagcaacttttatcaaagtgccccagaacccacat
ggcaaacctaaagggtatgcatttatagaatttgcttcatttgaagatgctaaagaagct
ttaaattcctgtaataaaatggaaattgagggcagaacaatcaggctggagttgcaagga
tccaattcgagaagtcaaccatccaaaactctgtttgtcaaaggtctgtctgaggatacc
actgaagagaccttaaaagaatcatttgagggctctgttcgtgcaagaatagtcactgat
cgggaaactggttcttccaaagggtttggttttgtagactttaatagtgaggaagatgcc
aaagctgccaaggaggccatggaagatggagaaattgacggaaacaaagttaccttggac
tgggccaaacctaagggtgaaggtggctttggtggtcgaggtggaggcagaggaggtttc
ggaggcagaggtggaggcagaggtggaagaggtggatttggaggaagaggccggggaggc
tttggaggtagaggaggcttccgaggcggcagaggaggagggggagacttcaagccacaa
ggaaagaagacgaagtttgaatag

DBGET integrated database retrieval system