KEGG   Mus musculus (mouse): 17995Help
Entry
17995             CDS       T01002                                 

Gene name
Ndufv1, CI-51kD
Definition
(RefSeq) NADH dehydrogenase (ubiquinone) flavoprotein 1
  KO
K03942  
NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:1.6.5.3 1.6.99.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    17995 (Ndufv1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    17995 (Ndufv1)
   05012 Parkinson's disease
    17995 (Ndufv1)
   05016 Huntington's disease
    17995 (Ndufv1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    17995 (Ndufv1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     17995 (Ndufv1)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     17995 (Ndufv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 3.72 cM; 19 A
AA seq 464 aa AA seqDB search
MLAARHFLGGLVPVRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRG
DWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHRAWQAAS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctagcggcacggcattttctcggcgggttggttcccgtgcgggtatctgtgcgtttc
agcagcggcacgacagcacccaagaaaacctcatttggctcactgaaggatgaagaccgg
atctttaccaacctgtatgggcgccatgactggaggctgaaaggtgccctgagacggggt
gactggtacaagacaaaggagatcctgctgaaggggcctgactggatcttgggtgagatg
aagacatcaggtttacggggccgtggtggtgctggcttccccactggcctcaagtggagc
ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaatgctgacgaggga
gagccaggcacctgtaaggaccgagagatcatgcgtcatgaccctcacaagctggtggaa
ggctgccttgtgggaggccgggccatgggagcccgggccgcctatatctacatccgaggg
gaattctacaacgaggcctccaatttgcaggtagctatccgagaggcctatgaagcaggt
ctgattggcaagaatgcttgtggctccgactatgattttgatgtgtttgtggtgcgtggg
gctggggcctacatctgtggagaagagacggcacttattgaatccattgaaggcaagcag
ggaaagccacgcctgaagccgccctttccagcagatgtgggagtgtttggatgccccaca
actgtggccaatgtggagacagtggctgtgtcccccaccatttgccgtcgtgggggcacc
tggtttgctggctttggccgagaacgcaattcaggtaccaaattgtttaacatctctggc
catgtcaaccacccctgcactgtggaggaagagatgtctgtgccactgaaagagctgatt
gagaaacatgctggtggtgtcacaggtggctgggacaacctccttgctgtgattcctggt
ggctcatctactccactgattcccaaatctgtgtgtgagaccgtgctaatggacttcgat
gcactggtgcaggctcagacaggcctgggcacggctgcagttattgttatggatcgctcg
acagacattgtgaaagccatcgctcgtctcattgagttctacaagcatgagagctgtggc
cagtgtaccccgtgccgtgagggcgttgactggatgaacaaggtgatggcccgatttgtg
aagggagatgcccggccagctgagattgactccctgtgggagatcagcaagcagatagaa
ggccacaccatttgtgctctgggtgatggggctgcctggccagtacagggtctgatccga
catttcaggccagagcttgaggatcggatgcaacgatttgcccagcagcaccgggcctgg
caggcagcctcgtga

DBGET integrated database retrieval system