KEGG   Mus musculus (mouse): 17995Help
Entry
17995             CDS       T01002                                 

Gene name
Ndufv1, CI-51kD
Definition
(RefSeq) NADH dehydrogenase (ubiquinone) flavoprotein 1
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:1.6.5.3 1.6.99.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer's disease
mmu05012  Parkinson's disease
mmu05016  Huntington's disease
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    17995 (Ndufv1)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    17995 (Ndufv1)
  Environmental adaptation
   04714 Thermogenesis
    17995 (Ndufv1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    17995 (Ndufv1)
   05012 Parkinson's disease
    17995 (Ndufv1)
   05016 Huntington's disease
    17995 (Ndufv1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    17995 (Ndufv1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     17995 (Ndufv1)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     17995 (Ndufv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-GeneID: 17995
NCBI-ProteinID: NP_598427
MGI: 107851
Ensembl: ENSMUSG00000037916
Vega: OTTMUSG00000034058
UniProt: Q91YT0
Position
19 3.72 cM; 19 A
AA seq 464 aa AA seqDB search
MLAARHFLGGLVPVRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRG
DWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHRAWQAAS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctagcggcacggcattttctcggcgggttggttcccgtgcgggtatctgtgcgtttc
agcagcggcacgacagcacccaagaaaacctcatttggctcactgaaggatgaagaccgg
atctttaccaacctgtatgggcgccatgactggaggctgaaaggtgccctgagacggggt
gactggtacaagacaaaggagatcctgctgaaggggcctgactggatcttgggtgagatg
aagacatcaggtttacggggccgtggtggtgctggcttccccactggcctcaagtggagc
ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaatgctgacgaggga
gagccaggcacctgtaaggaccgagagatcatgcgtcatgaccctcacaagctggtggaa
ggctgccttgtgggaggccgggccatgggagcccgggccgcctatatctacatccgaggg
gaattctacaacgaggcctccaatttgcaggtagctatccgagaggcctatgaagcaggt
ctgattggcaagaatgcttgtggctccgactatgattttgatgtgtttgtggtgcgtggg
gctggggcctacatctgtggagaagagacggcacttattgaatccattgaaggcaagcag
ggaaagccacgcctgaagccgccctttccagcagatgtgggagtgtttggatgccccaca
actgtggccaatgtggagacagtggctgtgtcccccaccatttgccgtcgtgggggcacc
tggtttgctggctttggccgagaacgcaattcaggtaccaaattgtttaacatctctggc
catgtcaaccacccctgcactgtggaggaagagatgtctgtgccactgaaagagctgatt
gagaaacatgctggtggtgtcacaggtggctgggacaacctccttgctgtgattcctggt
ggctcatctactccactgattcccaaatctgtgtgtgagaccgtgctaatggacttcgat
gcactggtgcaggctcagacaggcctgggcacggctgcagttattgttatggatcgctcg
acagacattgtgaaagccatcgctcgtctcattgagttctacaagcatgagagctgtggc
cagtgtaccccgtgccgtgagggcgttgactggatgaacaaggtgatggcccgatttgtg
aagggagatgcccggccagctgagattgactccctgtgggagatcagcaagcagatagaa
ggccacaccatttgtgctctgggtgatggggctgcctggccagtacagggtctgatccga
catttcaggccagagcttgaggatcggatgcaacgatttgcccagcagcaccgggcctgg
caggcagcctcgtga

DBGET integrated database retrieval system